[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF69088.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1qhbA.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "2bdtA1.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"

## Summary of PDB Search
:491
    1e-26  20%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    1e-25  25%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    6e-21   8%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    2e-20  19%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-20  16%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    8e-20  21%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    6e-19   6%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    6e-19  25%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    3e-18   9%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    9e-18  22%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    2e-17  11%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    7e-17   8%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    2e-16  11%  1g6oA  [c.37.1.11] CAG-ALPHA
    2e-16  12%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    3e-16   8%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    5e-16  13%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    6e-16  11%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    2e-15  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    6e-15   9%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    6e-15   7%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    1e-14  13%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    1e-14   8%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    5e-14  13%  1jb1A  [c.91.1.2] HPRK PROTEIN
    8e-14  12%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    9e-14   9%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    1e-13  13%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    2e-13  17%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-13   7%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    5e-13  10%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    6e-13  13%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    7e-13  14%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    1e-12  11%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    1e-12  28%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-12   9%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    2e-12   5%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    2e-12  11%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    3e-12  13%  1rkbA  [c.37.1.1] PROTEIN AD-004
    3e-12  11%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    3e-12   8%  1jbkA  [c.37.1.20] CLPB PROTEIN
    4e-12  10%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    6e-12  10%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    1e-11   6%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    1e-11  14%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    2e-11  13%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    2e-11   9%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    3e-11  15%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    3e-11  11%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    3e-11  11%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    5e-11  11%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    6e-11   8%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    6e-11  25%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-11  11%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    9e-11  14%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    9e-11  11%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    1e-10  15%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    1e-10  12%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    2e-10  17%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    2e-10   9%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    3e-10  14%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    3e-10  11%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-10  12%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    4e-10  10%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    6e-10  12%  1t3wA  [a.236.1.1] DNA PRIMASE
    6e-10  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    1e-09  10%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    1e-09  15%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-09   9%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-09  22%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-09  14%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    6e-09  10%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    6e-09   8%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    7e-09   8%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    9e-09   7%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    1e-08  10%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    1e-08   8%  1mi8A  [b.86.1.2] DNAB INTEIN
    2e-08  22%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-08  21%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    3e-08  15%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    3e-08  21%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    3e-08   8%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    7e-08   7%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    8e-08   8%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    1e-07  13%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    1e-07   8%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    4e-07  16%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    6e-07  10%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    6e-07  20%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    1e-06   8%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    4e-06  15%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    5e-06   9%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    6e-06  12%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    6e-06   8%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    9e-06  11%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    1e-05  13%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    2e-05  16%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    2e-05  12%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    2e-05   8%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    4e-05  13%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    5e-05  10%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    1e-04  12%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-04  39%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-04  13%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    3e-04   8%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    4e-04  16%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    4e-04  17%  1qhbA  [a.111.1.2] HALOPEROXIDASE
    5e-04  12%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    5e-04  23%  2bdtA1 [c.37.1.25] BH3686 A:1 -- 176
    5e-04  12%  1sbxA  [a.6.1.4] SKI ONCOGENE
    6e-04  18%  1g31A  [b.35.1.1] GP31
    7e-04  11%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    7e-04   8%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    8e-04  14%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 --
    3e-21  20%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER(query 2->191)
    3e-18  20%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE(query 2->201)
    2e-16   7%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE(query 17->198)
    6e-15  20%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 4->195)
    7e-14  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN(query 12->198)
    3e-15  19%  1ji0A  [c.37.1.12] ABC TRANSPORTER(query 4->210)
    2e-11   8%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 23->191)
    2e-18  24%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD(query 13->198)
    6e-11  15%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB(query 3->182)
    5e-12  19%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564(query 4->165)
    1e-14  15%  1e6cA  [c.37.1.2] SHIKIMATE KINASE(query 33->178)
    9e-10   8%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT(query 10->191)
    7e-15  15%  1ex6A  [c.37.1.1] GUANYLATE KINASE(query 33->183)
    3e-08   5%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379(query 1->190)
    1e-10   8%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3(query 35->192)
    1e-11  10%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)(query 1->186)
    2e-09  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622(query 15->187)
    9e-08  14%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN(query 23->188)
    5e-09   7%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA(query 116->185)
    2e-13  10%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223(query 27->256)
    6e-13   8%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336(query 282->437)
    7e-13   8%  1jb1A  [c.91.1.2] HPRK PROTEIN(query 23->176)
    1e-13  16%  1viaA  [c.37.1.2] SHIKIMATE KINASE(query 32->172)
    4e-11  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2(query 3->188)
    1e-07  13%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)(query 12->178)
    2e-07  12%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411(query 282->428)
    1e-12  13%  1n25A  [c.37.1.20] LARGE T ANTIGEN(query 23->198)
    3e-09   7%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198(query 111->192)
    3e-09  17%  1ffhA2 [c.37.1.10] FFH A:89 -- 295(query 23->198)
    2e-11  16%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278(query 29->178)
    4e-11  24%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -(query 82->191)
    1e-10   9%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251(query 23->198)
    6e-11  11%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK(query 27->198)
    1e-10  16%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181(query 28->192)
    9e-10  14%  1rkbA  [c.37.1.1] PROTEIN AD-004(query 26->184)
    1e-06   9%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --(query 29->198)
    6e-09  11%  1jbkA  [c.37.1.20] CLPB PROTEIN(query 3->168)
    2e-10  13%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206(query 29->167)
    4e-10  14%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165(query 33->178)
    2e-10  11%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381(query 127->209)
    8e-11   9%  1s9hA  [c.37.1.20] REP 40 PROTEIN(query 23->187)
    2e-07   8%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN(query 17->202)
    2e-07  15%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE(query 23->160)
    6e-09  23%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321(query 91->191)
    2e-07  11%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800(query 10->210)
    1e-08  12%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150(query 29->151)
    2e-08  10%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180(query 12->169)
    3e-05  21%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN(query 3->50)
    7e-11   8%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253(query 114->311)
    6e-09  13%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065(query 1->150)
    1e-10  10%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --(query 23->180)
    8e-07   9%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132(query 115->188)
    8e-09  15%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE(query 10->207)
    1e-08  14%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --(query 35->183)
    5e-07  16%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE(query 23->189)
    7e-09  10%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306(query 23->185)
    3e-05  10%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2(query 114->183)
    2e-09  14%  1t3wA  [a.236.1.1] DNA PRIMASE(query 42->182)
    2e-08   9%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2(query 29->198)
    5e-09  10%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188(query 23->173)
    3e-07  17%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE(query 33->172)
    1e-07   8%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445(query 124->176)
    9e-07  15%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA(query 119->172)
    3e-06  15%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87(query 114->198)
    7e-08  12%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173(query 113->202)
    9e-06  10%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348(query 114->173)
    2e-08  14%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS(query 33->192)
    4e-05   6%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)(query 15->119)
    3e-08   9%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE(query 286->461)
    2e-06  21%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA(query 2->64)
    1e-05  21%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1(query 33->191)
    3e-08  11%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607(query 395->469)
    9e-06  22%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 1->210)
    1e-05  12%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173(query 104->210)
    7e-06  10%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123(query 108->192)
    5e-05   5%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE(query 23->62)
    6e-04  10%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I(query 1->63)
    7e-06  15%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT(query 420->479)
    8e-05  13%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --(query 129->198)
    4e-04  41%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244(query 33->54)
    6e-04   7%  1g31A  [b.35.1.1] GP31(query 148->191)
:491

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSLQISQGTFRLSDTKTLHLDSLTLNAGDSWAFVGANGSGKSALARALAGELPLLTGERQCRFTRITRL
1sgwA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2yyeA2          --------------------ITQSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDK
1jb1A           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1lw7A2          -----------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKL
2iqhA1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1grqA           ---------------------------TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMP
1mi8A           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1qhbA           ------------------------------GSPFHPSYGSGHAVVAGACVTIL-----KAFFDANFQIDQ
1xl3C1          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1bifA1          ---------------------------------MVGLPARGKTYISKKLTRYL-----NFIGVPTREFNV
1sgwA           -SKLEIRDLSVGY-DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKV
1b0uA           -NKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAQNINLVRDKDG
1m3eA1          ----------------TDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNF
1q3hA           ---EKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCS
1e69A           -----------YLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
1ji0A           ---LEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNK
1khbA1          ----------------------TNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFD
1l7vC           ------------VAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTSG-KGSIQFAGQPLEAW
1e9rA           --GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1pf4A1          ---VDVKDVTFTYQGKEKPALSSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDY
1e6cA           --------------------------------FMVGARGCGMTTVGRELARALGYEGMTVADVVAAEGWP
1mjgM           ---------KLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIE-VIGPDIDQI
1ex6A           --------------------------------VISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1bmfA3          PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGKLYCIYVAIGQ
1mukA           ----------------------------------MCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPM
1cd5A           AGQVSFKHVVTFNMDEYVLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSY
1tljA           --------------REKALNKIYHDKEIGYLDPDILGF------LLAFYRNRNDVYTQSSCSGRITIVDA
1urjA           ----------------------KEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVVIAEPFNANHRSIGE
1f46A           ----------------------------------------------------------------------
1nijA1          --------------------------NPIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSV
2yyeA2          ----------------------------------------------------------------------
1jb1A           ----------------------LVDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQ
1viaA           -------------------------------IVFIGFXGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQ
1c4oA1          --TFRYRGPSPKGDQPKAIAGLVEALRDGERFTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQL
1qhlA           -----------TLINWNGFFARTFDLDEL-VTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVC
1lw7A2          ----------------------------------------------------------------------
1n25A           ----------------------VYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFE
1ohcA1          ----------------------------------------------------------------------
1ffhA2          ----------------------LPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
1jalA1          ----------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDP
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------TSKDKITKRXIVVLAXASLETHKIYVLLNCDD-HQGLLKKXGRDISEA
1kgdA           --------------------------HMRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEE
1zp6A1          ---------------------------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHDDLWGYIKHGR
1rkbA           -------------------------LMLLPNILLTGTPGVGKTTLGKELASKSKYINVGDLAREEQLYDG
1ak2A1          ----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVAS
1jbkA           --TERAEQGKLDPVIGRDEEIRVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLAL
2ancF1          ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGV
2axpA1          --------------------------------ILEGPDCCFKSTVAAKLSKELKYNEKLFEHFNKLADED
2vgmA3          ----------------------------------------------------------------------
1s9hA           ----------------------TKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFND
1t06A           ----------------KTVMQELEALGKERTKKIYISNGAHEPVFGVATGAM-----KPIAKKIKLNQEL
1poiA           ----------------------AKYVHSGDHIALGGFTTDRKPAVFEILRQGITDLTGLGGAAGGDWDML
1es6A2          ----------------------------------------------------------------------
1e3mA2          ---------VEQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGYVPAQKVEIGP
1xbtA1          ----------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKC--------LV
3cddA2          -----------KIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDD
1vplA           --AVVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIIS--------------------
2gk3A1          ----------------------------------------------------------------------
1fl9A           TQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEY
1pv4A3          ----------------------ASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDER
1dhyA1          ----------------------------------------------------------------------
1cr0A           ---------GLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
1yj5A2          ----------------------------------VGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCV
1d6jA           ----------------------ELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
1ni3A1          ----------------------WGRPGNNLKTGIVGXPNVGKSTFFRAITKSVL-GNPANYPYATIDPEE
1l3aA           ----------------------------------------------------------------------
1t3wA           -----------------------------------------KRTTXRILIGLLVQNPELATLVP------
1udwA           ----------------------------PFLIGVSGGTASGKSSVCA---------KIVQLLQKQVVILS
1atrA1          ----------------------AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD
1jjvA           --------------------------------GLTGGIGSGKTTIANLFTDLGPLVDADVVAR-------
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           --------------------------------AFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHEL
1ckvA           --------------ADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGY
1grqA           ----------------------------------------------------------------------
1g8yA           -ATHKPINILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGE------
1w1wA           --------------------------------SIIGPNGSGKSNMMDAISFVLGVLKDGPQSAYVKAFVE
1bs2A1          ----------------------------------------------------------------------
1g6hA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1bgxT2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------THSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFL--------
1i1qA           TKVDRYSYVMHLVSRVVGELRHDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGGA-------
1em8A           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1yr6A1          --------------------------------VFVGTAGSGKTTLTGEFGRYLE----------------
1g31A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SFEQLQKLVSDEWQRNNTDMLSPGEDDTGRTTAEIIQDEVHHPARCAMLAQQFGISALLDRRFKYLSTGE
1sgwA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2yyeA2          ARNLMLSLDATACLLGHAWNICKNSNIGRIFFEKVPYYQLSENLVKKKIYPKGAIENLNFVKNYLKSNLD
1jb1A           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1lw7A2          GGDEQAMQYSDYPQXALGHQ-----------------RYIDYAVRHSHKIAFIDTDFITTQAFCIQYEGK
2iqhA1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1grqA           LKMQSAEGGIEFDADGGVSIGPEFRALEGA-------WAEGVVAMARAGARIIIDDVFLGGAAAQERWRS
1mi8A           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bs2A1          ------------------------------------------------------TGPYLQYAHSRLRSVE
1g6hA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1i1qA           ---------------------------------------------------DDAFGAVVRQLQKAIRAGE
1em8A           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1qhbA           VFEVDTDEDKLVKSSFPGPLTVAG---------ELNKLADNV----AIGRNMAGVHYFSDQFESLLLGEQ
1xl3C1          ------------------------------------------PTPEIXVRFYQDLXRMFRLFPLGVFSDE
2bdtA1          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1gm5A1          -----------------------------------VEKMLKNQVNTRRIHQLLKELDDPLLENKDLEEKL
2gujA1          ----------------------------------------------------------------------
1bifA1          G-QYRRDMVK---TYKSFEFFLPDNEEGLKIRKQCALAALND--VRKFLSEEGGHVAVFDATN---TTRE
1sgwA           K--------GKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALESVEVLDLKKKLGELSQGT
1b0uA           QLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLKYLAKVGIDERAQGKYPVHLSGGQ
1m3eA1          GLGLLLQSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNK
1q3hA           QFSWIMPGTIKENIIFGVSY----------DEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1e69A           GSAYVELVFEENGEEIYYLNGSPVRLKDIRDRFAGTGLGVDFYGGEGRLEISIRKPGRRDQKLSLLSGGE
1ji0A           PAHVINRXGALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGE
1khbA1          AQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYGIDEPLASGVTITSWKNKE
1l7vC           SATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTE-----LLNDVAGALALDDKLGRSTNQLSGGE
1e9rA           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVV--PRGKTDEAEEWASYGRLLLRETAKKLA
1pf4A1          KLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAAREFIENMPQGLDTVIGENGTSLSGGQ
1e6cA           GFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASLQAHQRPTLTG
1mjgM           PEGSKLPLGILVDIYGRKMQADFEGVLERRI---HDFINYGEGLWHTGQRNINWLRVSKDAVAKGFRFKN
1ex6A           GEVNGKDYNFVSVDEFKSMIKNNEFIEWAQ---FSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKA
1bmfA3          KRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAY
1mukA           LQSTRKYFTLFMAKTVSGLDVNAIDS-----ALLRLRTLGADKKALTAQLLMVGLQEEADALAGKIMLQD
1cd5A           GKIHLFMGGVGNTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCV
1tljA           EMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHITGWDILKIAREAGFKHSGILATN
1urjA           KFTYFNRPLNRLLFEAVVGPAAVALDAVARAAAHLAFDENHEGAALPADITFTAFAG----GFEQRLASV
1f46A           ---------------------------------------------MKDFTTPGVTIFMQVPSYGDELQLF
1nijA1          DDQLIGDRATQIKTLTN---GCICCS-RSNELEDALLDLLDNLDKGNIQFDRLVIECTGMADPGPIIQTF
2yyeA2          ----------------------------------------------------------------------
1jb1A           TIVGAAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTISLIVHLENWTPDQLIFDVPVPKITVPVKVGR
1viaA           KVSEIFEQKRENFFREQEQKXADFFSSCKACIATGGGFVNVSNLEKAGFCIYLKADFEYKRPLFYDEIKA
1c4oA1          AAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRS-LLTRRDVISVSAI
1qhlA           YSMRLQQVAGRDRKVDIKPFAIQGLPMSVQPTQLVTE-------TLNERQARVLPLNELKDKLEAMEGDL
1lw7A2          ----------------------------------------------------------------------
1n25A           LGVAIDFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLKHLNKRTQIFPPGIVTMNEYSVPKTLQARF
1ohcA1          ----------------------------------------MVYRYCCKINKKLKSITMLRKKVHFTGSDQ
1ffhA2          AAREQLRLLGEKVGVPVLEVMDG-----------------ESPESIRRRVEEKARLEARDLILVDTAGRL
1jalA1          RLDALAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPLDDIDTI
1f2t.1          -----------ELASEIFAEFTEGKYS------EVVVRAEENKVRLFVVWEG------KERPLTFLSGGE
2v3jA1          RPDITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLVQLLHKLSIRSEEKLLK
1kgdA           NGKNYYFVSHDQMM----QDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAI----LDVEPQALKVL
1zp6A1          IDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVIL--DGVVRPDWLPAFTALARPLHYIVLRTTAAEAIE
1rkbA           YDEEYDCPILDEDRVVDENQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTD
1ak2A1          GSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPQAEMLDDLMEKRKEKLDSVIEFSI
1jbkA           DMGALVAGRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTLDEY
2ancF1          DVFLDIDWQGAQQIRQKMPHARSIFILPPSKIEQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTAL
2axpA1          NVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSV--IKKRLRVRGDEYIEGKD
2vgmA3          --------------------------------------------------------MVMDEFLLHLNKDD
1s9hA           CVDKMVIWWEEGKMTAKVV----ESAKAILGGSKVRVDQKC---KSSAQIDPTPVIVTSNTNMCAVIDGN
1t06A           AEELYATG------NYDAMYFAGIIADPKAMSESDFIDGAYFYMLSDYVVAVTLSESNIAQDVADKWIAS
1poiA           IGNGRVKAYINCYTANSGVTNVSRWFEAGKLTMEYSQDVIYMMWHAAALPVTLMQGSGLTDEWGISKEVR
1es6A2          --------------------LLPNKNSADLTSPEKIQ-------AIMTSLQDFKIVP--IDPTKNIMGIE
1e3mA2          IDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYF
1xbtA1          IKYAKDTRALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAI
3cddA2          WVPSYDESTITISVSGRDKT--ADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRI
1vplA           ----------------------------------------------------------------------
2gk3A1          -------------------------------------------TWLLECLRKGGVDIDQIAFPESIDELN
1fl9A           NIAYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADI--LVNIDYYDDARNIELIAQT
1pv4A3          PEEVTEXQRLVKGEVVASTFDEP----------ASRHVQVAEXVIEKAKRLVEHKKDVIILLDSITRLAR
1dhyA1          --------------------------------------------LGFAVKDVPAWDHFLTKSVGLMAAGS
1cr0A           E-ETAEDLIGLHNRVRLRQSDSLKREI----------------IENGKFDQWFDELFGNDTFHLYDSFAE
1yj5A2          SSCQAALRQGKRVVIDNTNPDVPSRARYIQCGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVSDXVXF
1d6jA           FGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHE---------VATPGE
1ni3A1          AKVAVPDERFDWLCEAYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFD--D
1l3aA           -------------------------------------------LSVTEIGSIISLGTDSCEFFHDPNKGR
1t3wA           -PLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATEKLSXWDDIADKNIAE--QTFTD
1udwA           QDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPAD
1atrA1          AAKNQVAMNPTNTVFDAKRLIGRRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTV
1jjvA           -----EVVAKDSPLLSKIVEH----FGAQILNRAALRERVFNHDEDKLWLNNLLHPAIRERMKQKLAEQT
2qgmA1          -----------------------------------------------------SIQSQANPLKTIEPSKP
1d8jA           ------------------------------------------------GDTHPLTLDEILDETQHLDIGL
2fggA1          -------------------------------------------GKTCQIDVLIEEHDERTRAKARLSWAG
1zs3A1          ------------------------------------------PVKCEYLREIAQREVEYFFKISDLLLDE
3cddA1          -------------------------------------------ILGDNVKAARGRFSWRQRFSKFTIKAA
1np6A           RKAGAAQTIVASQQRWALMT----------------ETPDEEELDLQFLASRMDTSKLDLILVEGFKHEE
1ckvA           WWIKANGKVDCDEISELLGRQFNVYDFLVDVSSTIGGNKFTITSELMGL---------------------
1grqA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1w1wA           LMRIISRNGDTSYKIDGKTVLENENILIKAKNFLVFQGDVEQIAALDAIYRELTGNASLTKDMEYLSGGE
1bs2A1          ----------------------------------------------------------------------
1g6hA           QTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQ
1bgxT2          ---------------------------------SLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRA
2f9hA1          -------------------------------------PEKDQVTLAEGDHLKIGDTNYTITKVGSFANSN
1afrA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------AHKKLEQVLVCL
1yr6A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TRKALLCQALMSEPELLILDEPFDGLDVTARQQLAQRLTALNQAGMTLALVLNRFDEIPDFVQFAGVLAD
1sgwA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1g6oA           ---------------LSAEDKKFLEVERALKEAALNPLHATEELFGDFLKXENITEICYNGNRLXHFARC
1ex6A           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2yyeA2          NWKLILLSDPVTSGGLLFTINK------EKLEKIDETAKELEVNYWIIGET-------------------
1jb1A           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1lw7A2          AHPFLDSXIKEYPFDVTILLKNNTE--QKQRQQFQQLLKKLPYIEIESPSYLDRYNQVKAVIE-------
2iqhA1          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1grqA           FVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEVEYDVEVDTTHKESI------------
1mi8A           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bs2A1          RNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLTHQVS--------
1g6hA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1i1qA           IFQVVPSRRFS-----LPCPSPLAAYYVLKKSNPSPYMFFMQDNDFTLFGASPPIAGTRPRGRRADGTLD
1em8A           ----------MKNATFYLLDNDTTVDGLSAVEQLVCEIAAEWRSGKRVLIA-------------------
1tmkA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1qhbA           IAIGILEEQSLTYGENFFFNLPK--FDGTTIQ--------------------------------------
1xl3C1          EQRQNLLQMCQNAIDMAIESE-------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1gm5A1          ------QAFLDYVKEIPNLPEARKRYRIQKSLEMIEKLRSWFLIDY------------------------
2gujA1          ----------------------------------------------------------------------
1bifA1          RRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDF---------------
1sgwA           IRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEGIVIISS-------------------
1b0uA           QQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHV---------
1m3eA1          DGSIAIASKPREVREFNGQHFILEEAIRGDFALV-KAWKADQAGNVTFRKSARNFNLP------------
1q3hA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM---------------
1e69A           KALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHNKIVM------------
1ji0A           QQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYVLET
1khbA1          WSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGV-------------------
1l7vC           WQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNHT------------
1e9rA           LIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAS----------------------------
1pf4A1          RQRVAIARALLRDAPVLILDEATSA---------------------------------------------
1e6cA           RPIAEEMEAVLREREALYQDVAHYVVDATQPAAIVCEL--------------------------------
1mjgM           YGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDRMRG-------------------
1ex6A           IPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQA---------------------------
1bmfA3          RQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIE--------------------
1mukA           VNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLNTDIPPRMGWL------------------
1cd5A           NHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL------------------------
1tljA           QKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQ-----------------------
1urjA           MAGDAALALESIVSMAVFDEPPTDISAWPLFEARANAVGAYLARAAGL----------------------
1f46A           KLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN-------------------------
1nijA1          FSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQ---VGYADRILLTKTDVAGEAEKLHERLARINA
2yyeA2          ----------------------------------------------------------------------
1jb1A           NLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIEH----------------------------------
1viaA           KKLYNERLSKYEQKANFILNIENKNIDELLSE--------------------------------------
1c4oA1          YGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRY----------------------
1qhlA           GIIARRLRSASDRSKFYRLIEAYGGISSAITRSLRDYL--------------------------------
1lw7A2          ----------------------------------------------------------------------
1n25A           VKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWRPVAEFAQSIQSRIVEWK------------
1ohcA1          RKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPYGSCNFYITLLDCF------------------
1ffhA2          QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDKVGVTGLVLTKLDGDA------------
1jalA1          NTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVME--------------------------------
1f2t.1          RFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILV-------------------
2v3jA1          VIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDVFVGAXARGKDNFADEYVDEK------------
1kgdA           RTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRT-YAHYFDLTIINNEIDET------------
1zp6A1          RCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINAL------------------
1rkbA           NIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKW--------------------------
1ak2A1          PDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSRGIHSAIDASQTPDVV------------
1jbkA           RQYIEKDAALERRFQKVFVAEPSVEDTI------------------------------------------
2ancF1          TDLKTIAERLRMSRQKQRHDALISKLL-------------------------------------------
2axpA1          IDSILLYREVXSNAGLHTYSWDTGQWSSDEIAKDIIFL--------------------------------
2vgmA3          DKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIAC-
1s9hA           STTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVV-----------------------
1t06A           GDESCYCWLLGNRKDNAFSESKISDMLEMVKDTIHHSPRTKSAMNNFLNTVAISYVPLHEKA--------
1poiA           KTLDKVPDDKFKYIDNPFKP--------------------------------------------------
1es6A2          VPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL-------------------
1e3mA2          ELTQLPEKXEGVANVHLDALEHGDTIA---FXHSVQDGAASKSYGLAVAALAGVPKEV---IKRARQKLR
1xbtA1          LNLVPLAESVV-----------------------------------------------------------
3cddA2          QIEQGETPHELLQRGVLLTSDTFGNLVIT-----------------------------------------
1vplA           ----------------------------------------------------------------------
2gk3A1          RYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYVK--NGGGLL--------XIGGYLSFXGEAKA
1fl9A           NLGKNIISAF------------------------------------------------------------
1pv4A3          AYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEGGSLTI------------------------------
1dhyA1          AGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALMADKLRQAG----------------------
1cr0A           AETDRLLARSGLGCDVIILDHI---SIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALRQLSDT---
1yj5A2          SYRKQFEPPTLAEGFLEILEIPFRLQE-HLDPALQRLYRQFSE---------------------------
1d6jA           ETGLPFVEVYVDVPVEAPYEAPANPEVHPVQDAVKQIIDYLDTKGYLPA---------------------
1ni3A1          AEIIHVEGDVDPIRDLSIIVDELLIKDAEFVEKHLEGLRKITSRG-------------------------
1l3aA           SDEGRVRKVLKVEP---LPDGSGHFFNLSVQNKLINLDENIYI---------------------------
1t3wA           SLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQELA----------------------------
1udwA           VVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITF------------
1atrA1          PAYFNDSQTIAGLNVLRIINEPTAAAIAYGLDK-------------------------------------
1jjvA           APYTLFVVPLLIENKLTALCDRILVVDVSPQT--------------------------------------
2qgmA1          FEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRL----------------------------------
1d8jA           KQKWLMTEALVNNPKIEVIDGKYAFKPKYNVR--------------------------------------
2fggA1          RQXVGVGLARL-----DPADEPVAQIGDELAIA-----RALSDLANQLFALTSSDIEA------------
1zs3A1          NEIVPSTTEEFLKYHKFITEDPKAKYW-TDEDLLESFIVDFQAQNMFITRAIKLANKEEKFA--------
3cddA1          KADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQW-------------------------------------
1np6A           IAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFV------------------
1ckvA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1w1wA           --KTVAALALLQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVI-------------------
1bs2A1          ----------------------------------------------------------------------
1g6hA           MKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFN
1bgxT2          PTPEDFPRQLALIKELVDLGLARLEVPGEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHP
2f9hA1          LQSIAHSTLIFADAPTDEDDVIRNGVYLTPHQLPKITI------GTTIDYLV------------------
1afrA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
2pa7A1          NGSCRVILDDGNIIQEITLDSPAVGLYVGP--AVWHEMHDFSSDCVMMVLASDYYDET------------
1yr6A1          ----------------------------------------------------------------------
1g31A           -------PIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVQGEPELCVVH-------------------


                         .         .         .         +         .         .         .:280
query           CXXXXXXXXXXXXQRALVAQLAHSERLTDVQLPEPDEPSARHALPDGEPRIVLNDGVVSYNDRPILHHLS
1sgwA           --------------------------------------------------LEIRDLSVGY-DKPVLERIT
1b0uA           -------------------------------------------------KLHVIDLHKRYGGHEVLKGVS
1m3eA1          ---------------------------------------------------------------TDAVEAV
1q3hA           ---------------------------------IMENVTAFWEEGFGELLEKVSFSHLCLVGNPVLKNIN
1e69A           ---------------------------------------------------------LYLKGFKSFGRPS
1ji0A           -----------------------------------------------DIVLEVQSLHVYYGAIHAIKGID
1khbA1          -----------------------------------------------------------LAEHMLVLGIT
1l7vC           -------------------------------------------------------------ESTRLGPLS
1e9rA           -------------------------------------------GTRIVSGGKLKRMTREKAKQVTVAGVP
1pf4A1          ---------------------------------ETERDNGKYEAERVNGEVDVKDVTFTYKEKPALSHVS
1e6cA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------ETRGIKLTKIKLDLPINFGPAFEG
1g6oA           CASFKKKTIDNYENPILSSNLANGERVQIVLSPVTVNDETISTTYPHSFFEEQGFYNLLDNKEQAISAIK
1ex6A           ----------------------------------------------------------------------
1bmfA3          -------------PVGEEL----LGRVVDALGNAIDGKGPIGSKAKAPGIIPRISVREPMQTGIKAVDSL
1mukA           ----------------------------------------------------------------------
1cd5A           --------------NRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKVSFKHVVTFNMDYVGLPKEH
1tljA           --------------------------------------------------------VWEELREKALNKIY
1urjA           --------------------------------------------GDLKHETTGEALCERLGLDPVTEGFK
1f46A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1jb1A           -------------------------------------------------------------ERRSXHGVL
1viaA           ----------------------------------------------------------------------
1c4oA1          --------------------------------------------------FRYRGPSPKGDQPKAIAGLV
1qhlA           -------------------------------------------------RGKFRS--LTLINWNGFFART
1lw7A2          ----------------------------------------------------------------------
2iqhA1          -------------QNSLTIE----RMVLSATGGPIYRRVDGKWRRELYDKEEIRRDATAGLTHMMIWHSN
1n25A           ------------------------------------------------------------------KCMV
1ohcA1          ----------------------------------------------------------------------
1ffhA2          -------------------------------------------------------------------ARL
1jalA1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ---------------------------------------------------------------PQAPVLT
1kgdA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jbkA           --------------------------------------------YTIDLTERAEQGKLDPGRDEEIRRTI
2ancF1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1qhdA1          -------------TIDYFVDFVDNVCMDEMVRESQRNGIAPQSDSLIKLSGIKFKRINFDNSSEYIENWN
2vgmA3          ----------------------------------------------------------------------
1s9hA           -----------------------------------------------------------YAASVFLGWAT
1t06A           ----------------------------------------------------------------VMQELE
1poiA           ---------------------------------------------------------------TLKDAIA
1es6A2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------QVLNEPFIANPL
1xbtA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------KIGITRSLEAXS
1vplA           --------------------------------------------------VVVKDLRKRIGKKEILKGIS
2gk3A1          ----------------------------------------------------------------------
1fl9A           -----------------------------------------------TQYIPDEFSMLRFGKKFAEILLK
1pv4A3          -------------------------------------------------KILFENLTPLHANSRLVLDLA
2vnuD1          ----------------------------------------------PKVRIRTRRAAELLDKRIVISIDS
1dhyA1          ----------------------------------------------------------------------
1cr0A           --------------------------------------------------------GLLFSGCTGINDKT
2gx8A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1d6jA           -----------------------------------------------------------ASALTRSERTE
1ni3A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1atrA1          --------------------------------------------------------------------PA
1jjvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ckvA           --------------------------------------------------AGIMGLKGKDFADQFFADEN
1grqA           ----------------------------------------------------------------------
1mi8A           -------------------------------------GDSLISLASTGKRVSIKDLLDEKDFEIWAINEQ
1g8yA           --------------------------------------------------HKPINILEAFAAPPPLDYVL
1w1wA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1g6hA           ------------------------------------------------EILRTENIVKYFGEFKALDGVS
1b77A2          -----------------------------------------------------------------VASVI
1bgxT2          ----------------------------------------------------------------------
2gtlM1          ------------------------HVGSSY-TGLATWTSCEDLNPDHAIVTITAAHRKSFVWLRATLSYE
2f9hA1          ----------------------------------------------------------------------
1afrA           -------------------------------------------------------------PREVHVQVT
1l1oA           ---------------------------------------------------------MMDLPRSRINAGM
1i1qA           RDLDSRIELDMRTDHKELSEHLMLVDLARNDLARICTPGSRY-VADLTKVDRYSYVMHLVVVGELRHDLD
1em8A           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1esmA           -------------DRNQWAALRDSVPXT-LSEDEIARLKGINEDLSLEELPLSRLLNFYIQAVLEQFLGT
1f8xA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------WKGEVL
1o7d.2          ----------------------------------------------------------------------
1odfA           ---------------------------------------------------TVLDYTIEFLDKYIPEWFE
2pa7A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1tueA           -------------------------------------------------QFLRYQQIEFITFLGALKSFL
1iqrA2          ----------------------------------------------------------------------
1ii8.1          ------------------------------------------------------------------FETA
1yr6A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------RRVLPKNPDKHLEAGCDAAAASNEKFRGVR
1g8fA3          ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1nijA1          RAPVYTVTHGDIDLGLLFNTNGF--MLEENVVSTKPRFHFIADQND------------------------
2yyeA2          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2gk3A1          N-------YKNTVLAEVLPVIXLDGDDRVEKPEGICAEAVSPEHPVVNGFSDYPVFLGYNQAVARDDADV
1fl9A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WRVNPGEHWQIVGPNGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGYVSSSLHLDYR
1sgwA           MTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLK-------GEIIYNGVPITKVKGKIFFLPEEIIVPR-
1b0uA           LQARAGDVISIIGSSGSGKSTFLRCINFLEKP-SEGAIIVNGQNVADKNQLRLLRTRLTMVFQHFNLWSH
1m3eA1          KDIPNGATVLVGGFGLCGIPENLIGALLKTVKELTAVSNNAGVDNFGLGLLLQSKQIKRXISSYVGENAE
1q3hA           LNIEKGEMLAITGSTGSGKTSLLMLILGELEA-SEGIIKHSGRVS-FCSQFSWIMPGTIK----------
1e69A           LIGFSDRVTAIVGPNGSGKSNIIDAIKWVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSIV
1ji0A           LKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNG-------QDITNKPAHV-INRXGIALVPE
1khbA1          NPEGEKKYLAAAFPSACGKTNLAMMNPSLPG--WKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGT
1l7vC           GEVRAGEILHLVGPNGAGKSTLLARXAGXTS---GKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFA
1e9rA           MPRDAERHLLVNGATGTGKSVLLRELAYTGLLRG-DRMVIVDPNGDM---LSKFGRDKDIILNPYDQ-RT
1pf4A1          FSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSI--CLDGHDVRDYKLTNLRRHFALVSQNVHLFND
1e6cA           ------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQ
1mjgM           ESIRKGDMYVEMGGNRTPAFELVRTVSESEITDG----KIEVIGPDIDQIPEGSKLPLGILVDIYGRKMQ
1g6oA           DGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVFKHHKNYTQLFF-------GGNIT
1ex6A           ----------ISGPSGTGKSTLLKKLFAYPDSFGFSVS------STTRTPRAGEVNGKDYNFVSVDEFKS
1bmfA3          VPIGRGQRELIIGDRQTGKTSIAIDTIINQKR-FNDGTDEKKKLYCIYVAIGQKRSTVAQLVK--RLTDA
1mukA           ---------WRMCEAREPSVDLLPLCAGIDPL--NSDPFLKMVS--VGPMLQSTRKYFAQTLFMAKTVSG
1cd5A           PESYYSFMHRNFFDHVDIPAENINLLNGNAPDSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTH
1tljA           HDKEIGYLDPDILG------FLLAFYRNRND--VYTQSSCSGRITIVDAEMPWDRKNSTIIFKNHLRITE
1urjA           EAVCINNTFLHLG--GSDKVTIGGAEVHRIPV-YPLQLFMPDRVIAEPFNANHRSIGEKFTYPLPFFNRP
1f46A           --------------------IIMNVAAH-------------HGSELNGELLLNSIQQAGFIFGDMNIYHR
1nijA1          ---NPIAVTLLTGFLGAGKTTLLRHILNEQHGYK-------IAVIENEFGEVSVDDQLIGDRATQIKTLT
2yyeA2          ----------------------------------------------------------------------
1jb1A           VDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQD-----EQTIVGAAPPILSHLLEIRG
1viaA           ------KNIVFIGFXGSGKSTLARALAKDLDLVFDSDFLIEQKFNQKVSEIFEQKRENFFREQEQKXADF
1c4oA1          EALRDGERFVLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYY
1qhlA           FDLDELVTT-LSGGNGAGKSTTMAAFVTALIPDL-------TLLLHGKLKAGVCYSMLDTINQRVVVGVR
1lw7A2          ----------------------------------------------------------------------
2iqhA1          LNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSG---AAGAAVKGVGTMVMELIRMIKRGINRRTRIAY
1n25A           YNIPKKRYWLFKGPIDSGKTTLAAALLEALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSG
1ohcA1          ----------------------------------QDDVYLDITDRLCFAILYRPKSASNVHYFSID-NEL
1ffhA2          PVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRR--PLLVAADTQRPAAREQLRLLGEKVGVPVLEVM
1jalA1          -----GFKCGIVGLPNVGKSTLFNLTKAGPFCTIEPNTGVVPMPDPRLDALAEIVKPERILPTTME----
1f2t.1          ----------------------------------------------------------------------
2v3jA1          SKDKITKRXIVVLAXASLETHKIYVLLNCDDHQ--------GLLKKXGRDISEARPDITHQCLLTLLDSP
1kgdA           ---HMRKTLVLLGAHGVGRRHIKNTLITKHPD-------------RFAYPIPHTTRPPEENGKNYYFVSH
1zp6A1          -----GNILLLSGHPGSGKSTIAEALANLPGVP-------KVHFHSDDLWGYIKHGRIDPWLSHQQNRXI
1rkbA           --LMLLPNILLTGTPGVGKTTLGKELASGLKYINVGDLAREEQLYDGYD------EEYDCP---ILDEDR
1ak2A1          -----GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVA-----SGSELGKKLKATMDAGKLV
1jbkA           LQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVL
2ancF1          -----GTLYIVSAPSGAGKSSLIQALLKQPLYDAIEQVLATGVDVFLDIDWQGAQQIRQKMPH--ARSIF
2axpA1          ----------LEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVY
1qhdA1          LQNRRQRTSVLADASETMLANVTSVRQEYAIPV--------GPVFPPGMNWTDLYSPSREDNLQRVFT--
2vgmA3          ----------------------------------------------------------------------
1s9hA           KKFGKRNTIWLFGPATTGKTNIAEAIAHTVP-------FYGCVNWTNENFPFNVDKMVIWWEEGKMTAKV
1t06A           -ALGKERTKKIYISNGAHEPVFGVATGAMKPIAKK-----IKLNQELAEELYATGNYDAMYFAGIIADPK
1poiA           KYVHSGDHIALGGFTTDRKPYAAVFE---ILRQGITDLTGLGGAAGGDGNGRVKAYINCYTAN--SGVTN
1es6A2          ----------------------------------------------------------------------
1e3mA2          NLSPQRRXLIITGPNXGGKSTYXRQTALIAL-XAYIGSYVPAQKVEIGPIDRIFTRVGFXVEXTETANIL
1xbtA1          -----GQIQVILGPMFSGKSTELMRRVRRFQI-AQYKCLVIKYAKDTRALPACLLRDVAQEALGVAV---
3cddA2          GAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWVPSYDESTITIS-----VSGRD
1vplA           FEIEEGEIFGLIGPNGAGKTTTLRIIS----------TLIKPSSGIVTVFGKNVVEEPHEVRKLISYLPE
2gk3A1          ----------------------------------------------------------------------
1fl9A           LHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPE----
1pv4A3          SPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAY-NHPDCVLXVLL-------------IDERPEEVTEXQR
2vnuD1          WPTTLGHFVRDLGTIESAQAETEALLLE------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1cr0A           LGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSD---
2gx8A1          -----------------------------------------------SLQRKVIKAMVTAHPYEEVAYDV
1yj5A2          -----------VGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVI---DNTNP
1d6jA           LRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDR-------------RVHAYRLDGDNIRFGLNKDLGFS
1ni3A1          -RPGNNLKTGIVGXPNVGKSTFFRAITKSVLG-NPANYPYATIDPEEAKVAVPDERFD-WLCEAYKPKSR
1l3aA           ----------------TPKVFVGYSIYKGK------AALTVEPRSPEF-----SPLDSGAFKLSREG---
1t3wA           ------------------KRTTXRILIGLLVQ-----------NPELATLVPPLENLDEN---KLPGLGL
1udwA           -----PFLIGVSGGTASGKSSVCAKIVQLLQ--KQVVILSQDSFYRVLTSEQKAKALKGQ----------
1atrA1          VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAG
1jjvA           -----TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVV----AREVVAKDSPLLSKIVEHFGAQILNR-
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           -----IPLLAFAAWSGTGKTTLLKKLIPALCARG-----------------IRPGLI--------KHTHH
1ckvA           QVVHESDTVVLVLKKSDEINTFIEEILLTDYVEDRAGYWWIKANGKIEVDCDEISELLGRQFNVYDFLVD
1grqA           ----------------------------------------------------------------------
1mi8A           TMKLESAKVSRVFMTGKKLVYILKTRLGRTIKATA---NHRFLTIDGWKRLDELSLKEHIALPRKSDISW
1g8yA           PNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGP------------------------------------
1w1wA           ----------IIGPNGSGKSNMMDAISFVL--GVLKDLIYRGPQSAYVKAFYQKGNKLVELMRIISRNGD
1bs2A1          ----------------------------------------------------------------------
1g6hA           ISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEM
1b77A2          TEIKAEDLQQLLR-----VSRGLQIDTIAITN-KDGKIVINGYNKVEDSGLTRPKYSLTLTDYDGSNNFN
1bgxT2          ----------------------------------------------GRVLLVD---GHHLAYRTFHALKG
2gtlM1          LDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQ--SEGYGVICDLGDDDHADCKIVPSSLFVCAHFNAQ--
2f9hA1          ------------------------------------------------ATVTEIGKHAIDDSEKXIILFG
1afrA           HSMPPQKIEIFKSLDNWAEENILVHLKP------------------------------------------
1l1oA           LAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKN----GTIELMEPLDEEISGIVEVVGRVTAKATI--L
1i1qA           ALHAYRACMNMGTLSGAPKVRAMQLIADAE-------------GQRRGSYGGAVGYFTAHGDLDTCI---
1em8A           ----------------------------------------------------------------------
1tmkA           ----RGKLILIEGLDRTGKTTQCNILYKKL-------------QPNCKLLKFPERSTRIGGLINEYLTDD
1esmA           NGQRIPYIISIAGSVAVGK---------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1l7lA           ANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQK-------WGPQGDREHPDQGLICHDAFCGALVMKIG
1o7d.2          ----------------------------------------------------------------------
1odfA           TGNKCPLFIFFSGPQGSGKSFTSIQIYN------------------HLMEKYGGEKSIGYASIDDFYLTH
2pa7A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1tueA           KGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGA-------VISFVNSTSHFWLTDTKVAMLDDATTTCWT
1iqrA2          ----------------------------------------------------------------------
1ii8.1          YKKLSELKKTINNRIKEYRDILARTERERVKKEIKDLEKAKDFTE------ELIEKVKKYKALAREAALS
1yr6A1          ----------FVGTAGSGKTTLTGEFGR------------------------------------------
1mkyA1          ----------IVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKLVDTCGVFDNPQDIISQKXKEVTLNXI
1jqjA3          LYVSENQLKITANNPEQEE---------------------------------------------------
1g8fA3          -RPKQGFSIVLGNSLTVSREQLSIALLSTFLQRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPDQWEDDK
1qhbA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2bdtA1          --------YIITGPAGVGKSTTCKRLAAQLDSAYIEGDIINHXVVGGYRPPWESDE-------LLALTWK
1sbxA           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2gujA1          ---------------KKGSDPYFTLQAVDDQSSGRGTERVTLY----DVNFDSAKEEVPFTFEDFDV---
1bifA1          ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2yyeA2          -GAQVGQLLILTKPIGTGILIKGLKEGILKE--EDINEAIENMLALNDKARNLMLSLDATACTDVTGFGL
1jb1A           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1lw7A2          -RPFFAKTVAILGGESSGKSVLVNKLAAVFNTT-------SAWEYGREFVFEKL----------------
1n25A           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2gk3A1          VLTINNDPLLVFGEYQQGKTACFXSDCSPHW---------------------------------------
1fl9A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1grqA           -----TRMIILNGGSSAGKSGIVRCLQSVLPEP-------WLAFGVDSLIEAMPLKMQSAE-------GG
1g8yA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VSTTVRNVILSGYFDSIGIYQAVSDRQRKLAQQWLDILGIDKRTADAPFHSLSWGQQRLALIVRALVKHP
1sgwA           ----KISVEDYLKAVASLYGVKVNKNEIMDALESVEVLDLKKK-----LGELSQGTIRRVQLASTLLVNA
1b0uA           --MTVLENVMEAPIQ---VLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEP
1m3eA1          FERQYLAGELEVELTPQGTLAERIRAGGAGVPAFYTSTGYGTL-VQEGGSPIKYNKDGSIAIASKPREVR
1q3hA           ------ENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTV-LGEGGVTLSGGQRARISLARAVYKDA
1e69A           GQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGR-RDQKLSLLSGGEALVGLFALMEIKPS
1ji0A           GRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQXLAIGRALXSRP
1khbA1          SVKTNPN-----AIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNS
1l7vC           --TPVWHYLTLHQHD---------KTRTELLNDVAGALALDDK-LGRSTNQLSGGEWQRVRLAAVVLQIG
1e9rA           KGWSFFNEI-----RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET-AKKLALIGTPSMRELFHWT
1pf4A1          TIANNIAYAAEGEYTREQIEQAARQAHAM-EFIENMPQGLD-TVIGENGTSLSGGQRQRVAIARALLRDA
1e6cA           AVATPNRVVATGGGMVLLEQNRQFMRAHGTLFAPAEELALRLQASLQAHQRPTLTGRPIAEEMEAVLRER
1mjgM           ---------ADFEGVLERRIHDFINYGEGLWHTGQRNINWLRVSKDAVAKGFRFKNYGEILVAKMKEEFP
1g6oA           SADCLKSCLRXRPD----RIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAIRLANXSNSAARNI
1ex6A           MIKNNEFIE------WAQFSGNYYGSTVASVKQVSKSGKTCIL-DIDMQGVKSVKAIPELNARFLFIAPP
1bmfA3          DAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALI-IYDDLSKQAVAYRQMSLLLRRPPGRE
1mukA           LDVNA--------IDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAV
1cd5A           DTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPK
1tljA           QDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREAGFKH-SGILATNQKGVLVELRTGIRM
1urjA           LNRLL--------FEAVVGPAAVALRSRNVFDENHEGAALPAD-ITFTAFAGGFEQRLASVMAGDAALAS
1f46A           --HLSPDGSGPALFSLANMVK---PGTFDPEMKDFTTPGVTIFMQVPSYGDELQLFKLMLQSAQHIADEV
1nijA1          NCCSRSNELEDALLD---LLDNLDKGNIQFDRLVIECTG------MADPGPIIQTFFSHEVLCQRYLLDG
2yyeA2          ----------------------------------------------------------------------
1jb1A           LGIID-VXNLFGAGAVREDTTISLIVHLENWTPDQLIFDVPVPKITVP---VKVGRNLAIIIEVAAXNFR
1viaA           F-SSCEKACIATGGGFVNVSNLEKAGFCIYLKADFEYLKKRLDKDEIPLFYDEIKAKKLYNERLSKYEQK
1c4oA1          QPEAYVPGKDLYIEKDASINPEI-ERLRHSTTRSL----LTRR--DVIVVASVSAIYGLGDPREYRARNL
1qhlA           LQQDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMEGVQFKQFSLMFDLRLRSASDRS
1lw7A2          ----------------------------------------------------------------------
2iqhA1          --ERMCNILKGKFQ--TAAQRTMVDQVRESRNPGNAEFEDLIF-LARSALILRGSVAHKSCLPACVYGSA
1n25A           QGINNLDNLRDYLDGSVKVN---LEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKH
1ohcA1          EYENFYADFGP-------LNLAMVYRYCCKINKKLKSITM---LRKKIVHFTGSDQRKQANAAFLVGCYM
1ffhA2          -----------------------DGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEP-LMGELARLK
1jalA1          --FVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENI----DPLDDIDTINTELALADLDSCER
1f2t.1          ------------------------------AEENKVRLFVVWEGKERPLTFLSGGEFRLAMS-LYLAGEI
2v3jA1          INKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIR-SEEKLLKVIKNPITDHLPTKC
1kgdA           DQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHE----QGLIAILDVEPQALKVLRTAEFAPFVVFIAA
1zp6A1          XQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCLDRGG---DSLSDPL
1rkbA           VVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDVLYERLETRGYNEKKLTDNIQCEIFQVLYEEA
1ak2A1          SDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLI
1jbkA           NDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARG------ELHCVGATTLDEYRQYIEKDAALERRF
2ancF1          ILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSR
2axpA1          SNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYDPSVIKKRLRVRGDEYIEGKDSILE-LYREVXSNA
1qhdA1          -VASIRMLV-------------------------------------------------------------
2vgmA3          -------------------------KEIMVMDEFLLHLNKDDDK-------AWYGEKEVV-KAAEYGAIS
1s9hA           VE----------SAKAILGGSKVRVDQKCKSSAQIDPTPVIV-TSNTNMCAVIDGNSTTFEHQQPLQDRM
1t06A           A-MSESDFDRWIDGAYF------YMLSDYVVAVTLSESNIAQDVADKWIASGDELKMSAGWYCWLLGNRK
1poiA           VSRRFRKWFEAGKLTMEDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTGISKEVRKTLDKVPDDKFKYI
1es6A2          ---SFHPKLRPILLPNKNSADLTSPEKIQAIMTSLQDFKIV---PIDPTKNIMGIEVPETLVLKLTGGQP
1e3mA2          HNATEYSLVLXDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATH-------YFELTQLPEKXE----
1xbtA1          ------------IGIDEGQFFPDIVEFCEAMANAGKTVIVAAL-DGTFQRKPFGAILNLVPLAESVVK--
3cddA2          KTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIEQGETPHELLARLAKQ-R
1vplA           EAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNP
2gk3A1          ---------------------------ATWLLECLRKGGVDHTVQIAFPESIDELNRYDVIVISDIGSNT
1fl9A           ---ELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQTNLGKNIISAF----
1pv4A3          LVKGEVVASTFDEPASRHVQVAEXVIEKAKRLVE-----HKKDVIILLDSITRLARAYNTVVPAVLTGGV
2vnuD1          ----------------------------------------------------------------------
1dhyA1          -------------------------RLGYLGFAVKDVPAWDHF-LTKSVGLMAAGSAGDAALYRADQRAW
1cr0A           --SLKREIIENGKFD-----------------QWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLC
2gx8A1          --YPLDNKGETLGLGKI-------GYLQEEMTLGQFAEHVKQSLDVKGARVVGKLDDKVR-KVAVLGGDG
1yj5A2          DVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVSDXVXFSYRKQ--FEPPTLAEG
1d6jA           EADRNENIRRIAEVAKLFADS----NSIAITSFISPYRKDRDTARQLHEVATPGEETGLP-FVEVYVDVP
1ni3A1          VPAFLTVFDIAGLTKGA-------STGVGLGNAFLSHVR-AVDAIYQVVRAFDDAEIIHVEGDVDPIRD-
1l3aA           ---MVMLQFAPAAG-VRQYDWSRKQVFSLSVTEIGSIISLGTKDSCEFFHDPNKGRSDEGRVRKVLKVEP
1t3wA           FRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSXWDDIADKNIAE---QTFTDSLNHXFDSLLELRQ
1udwA           ------FNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQE
1atrA1          RPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFN-DSQRQATKDAGTIAGLN
1jjvA           ------------------AALRERVFNHDEDKLWLNNLLHPAI-RERMKQKLAEQTAPYTLFVVPLLIEN
2qgmA1          -----------------------SGQSV--QKNIVKSIQSQ---ANPLKTIEPSKPFEDLKPLKKXIGNA
1d8jA           ----------------------------KTRHQRGDTHPLTLDEILDETQHLDIGLQKQWLMTEALVNNP
2fggA1          --------------------------HVGKTCQIDVLIEEHDE-RTRAKARLSWAGRQXVGVGLAR----
1zs3A1          ------------------------AKSPVKCEYLREIAQREVE-YFFKISDLLLDENEIVPSTTEEFLKY
3cddA1          -------------------------VSLILGDNVKAARG-RFSWRQRFSKFTIKAAKADVTDSEIGRYRP
1np6A           ELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHR
1ckvA           --VSSTIGRAYT-----------LGNKFTITSE---LMGLDRKLEDY-----------------------
1grqA           ----------------------------------------------------------------------
1mi8A           DSIVSITETGVEEVFDL----TVPGPHNFVANDII-----------------------------------
1g8yA           ----------------------------------------------------------------------
1w1wA           TSYKINFLVFQGDVEQIAAQSPVELSRMFTFDYVSDHLDARELTGNADMEYLSGGEKTVAALALLFAINS
1bs2A1          ----------------------------------------------------------------------
1g6hA           TVLENLLIGEICPGESPKKWIPKEEEMVEKAFKILEFLKLSHL-YDRKAGELSGGQMKLVEIGRALMTNP
1b77A2          FVINMANMKIQPGNYKVMLWGA-----GDKVAAKFESSQVSYVIAMEADSTHD-----------------
1bgxT2          L-TTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKE
2gtlM1          ----------------------------------------------------------------------
2f9hA1          --ETATDTLKQHAV-----IQSFPEKDQVTLAEGDHLKIGDTNYTITKVGSFANSNLQSIAHSTLIFADA
1afrA           ----------------------------------------------------------------------
1l1oA           CTSYVQFKEDSHPFDLGLYNEAV-----KIIHDFPQFY--------------------------------
1i1qA           ---VIRSALVEN----GIATVQAGAGIVLDSVPQSEADETRNKARAV--------LRAIAT---------
1em8A           ----------------------------------------------------------------------
1tmkA           SFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQPDVGLLKP
1esmA           ----------------------------------------------------------------------
1f8xA           -----------------------------------------KKTIYFGAGWFTDRQNKAYKEAMEALKEN
1v47A1          --------------------------------------------------------PALE-IGEDERLDL
1j1zA2          ---------------------------PEEAPDAPEYVEVEFF--EGDPVAVNGERLSPAALLQ----RL
1l7lA           GTIPVNTGLF--------RWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQ--------------
1o7d.2          -------------------------------------------------------RKVDW-MVRLPVSKH
1odfA           EDQLKLNEQFKN-NKLLQGRGLPGTHDMKLLQEVLNTIFNQDTV-VLPKKSQFKGEGDRCPTGQKIKLPV
2pa7A1          ------------------------------------------KKLEQVLVCLNGSCRVILDDGNI----I
1yvuA2          ---------------------------KEIEGKVDAFVGID-------ISRITRDGKTVNAVAFTKIFNS
1tueA           YFDTYMRNALDGNPISID----------------------------------------------------
1iqrA2          ---------------------------HPALLEALARGPVVGL-VVLDPNNLKTTPRRRAWFLENVRA--
1ii8.1          KIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEI
1yr6A1          ----------------------------------------------------------------------
1mkyA1          READLVLFVVDGKRGITKEDESLADFLRKSTVDTI----LVANKAE-----NLREFEREVKPELYSLGFG
1jqjA3          ----------------------------------------------------------------------
1g8fA3          DSVVGKNVYLLDTSSSADIQLESADEIVQKVVLFLEDNGF------------------------------
1qhbA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2bdtA1          NITDLTVNFLLAQNDVVLDYIAFPDEAEALAQT------VQAKVDDVEIRFIILWTNREELLRR------
1sbxA           -------------------------------------------------SDRSTERCETVLISCFVVGGE
1g31A           ---------------------------------------------------------------PIRAVGE
1gm5A1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2yyeA2          LGCKNSNIGARIFFEKVPYYQL---SENLVKKKIYPKGAIENL-NFVKNYLKSNLDNWKLILLSDPVTSG
1jb1A           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1lw7A2          GGDEQAMQY--SDYPQXALGHQRYIDYAVRHSHKI-AFIDTDFITTQAFCIQYEGKAHPFLDSXIKEYPF
1n25A           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1grqA           IEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGV--RC
1g8yA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bs2A1          --------------------------------------------LQYAHSRLRSVERNASGITQEKWINA
1g6hA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1em8A           ---------------------------------------------------------------------A
2pa7A1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVLILDEPLQGLDPLNRQLVRRFVDVLIRQGETQLLFVSHHAEDAPACITHRLEFVPEGERYKYVSxxxx
1sgwA           EIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSREELSYC-------------------------
1b0uA           DVLLFDEPTSALDPELVGEVLRIMQQLAEEGKT-MVVVTHEMGFAR-HVSSHVIFLHQGK----------
1m3eA1          EFNGQHFILEEAIRGDFALVKAW--KADQAGNVTFRKSARNFNLPXC-----------------------
1q3hA           DLYLLDSPFGYLDVFTEEQVFESCVCK-LMANKTRILVTSKMEHLRKA----------------------
1e69A           PFYVLDEVDSPLDDYNAERFKRLLKEN--SKHTQFIVITHNKIVMEAA----------------------
1ji0A           KLLXXDEPSLGLAPILVSEVFEVIQKINQEGTT-ILLVEQNALGA-LKVAHYGYVLETGQ----------
1khbA1          RFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHG---------------------
1l7vC           QLLLLDEPXNSLDVAQQSALDKILSALCQQGLA-IVXSSHDLNHT-------------------------
1e9rA           TIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDG-------------------
1pf4A1          PVLILDEATSALDTESERAIQAA--LDELQKNKTVLVIAHRLSTIEQA----------------------
1e6cA           EALYQDVAHYVVDAPPAAIVCELMQTM-------------------------------------------
1mjgM           AIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDRMRGLTDETVDTFYSCVLCQSFAPN------------
1g6oA           KESLIEGFKDLIDXIVHINHHKQCDEF-------------------------------------------
1ex6A           SVEDLKKRLEGRGTETEESINKRLSAAQAE-----LAYAETGAHDKVIVNDDLDKA--------------
1bmfA3          AYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAY---IPTNVISITDGQ----------
1mukA           PDTWMSLDFDSMFKHHVKLLPKDGRHLNTDIPPRMGWLRA------------------------------
1cd5A           AIMVCDEPSTMELKVKTLRYFNELEAENIKG---------------------------------------
1tljA           VHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMN-LLKDL----------------------------
1urjA           MAVFDEPPTDISAWPLFEGQDTAAARAYLARAAGLVGAMVFSTNSALHEVDDAGPAHSKPSF--------
1f46A           GGVVLDDQRRMMTPQKLREYQDIIREVKDAN---------------------------------------
1nijA1          VIALVDAVHADEQMNQFTIAQSQVG---YADRIL-LTKTDVAGEA-EKLHERLARINARAPVYTVT----
2yyeA2          ----------------------------------------------------------------------
1jb1A           AKSXGYDATKTFEKNLNHLI--------------------------------------------------
1viaA           ANFILNIENKNIDELLSEIKK-------------------------------------------------
1c4oA1          VGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERT-------------------
1qhlA           KFYRLIEAYGGISSAITRSLR---DYLLPE----------------------------------------
1lw7A2          ----------------------------------------------------------------------
2iqhA1          VASGYDFEREGYSLVGIDPFRLLQNSQVY-------SLIRPNENPA-HKSQLVWMACHSA----------
1n25A           CLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSR------------------------------
1ohcA1          VIYLGRTPEEAYRILIFGIPFRDAAYGSCNFYITLLDCFHAVKKA-------------------------
1ffhA2          EVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSA-----------------
1jalA1          AIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRSVGLDKEE-------------------------
1f2t.1          SLLILDEPTPYLDEERRRKLITIMERYLKKI-PQVILVSHDEELKDAA-DHVIRISLEN-----------
2v3jA1          RKVTLSFDAPVIRVQDIEKLDDDESICVFVGAXARGKDNFADEYV-------------------------
1kgdA           PTITPGLNEDESLQRLQKESDIL--QRTYAHYFDLTIINNEIDETIRHLEEAVELV--------------
1zp6A1          VVADLHSQFADLGAFEHHVLPVSGKDTDQALQS--AINALQSG---------------------------
1rkbA           TASYKEEIVHQLPSNKPEELENNVDQILKW----------------------------------------
1ak2A1          HSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFS----------------
1jbkA           QKVFVAEPSVEDTI--------------------------------------------------------
2ancF1          QKQRHDALISKLL---------------------------------------------------------
2axpA1          GLHTYSWDTGQWSS--DEIAKDIIFLV-------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2vgmA3          YLLLTDKVLHSDNIAQREEYLKLMDSVESNGGK-ALVLSTLHSLGEEL----------------------
1s9hA           FKFELTRRLDHDFGVTKQEVKDFFRWAKDH----------------------------------------
1t06A           DNAFSESKISDMLEMVKDTIHHSPERTKSAMNNFLNTVAIS-------YVPLHEKA--------------
1poiA           DNPFKP----------------------------------------------------------------
1es6A2          IIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPAS----------------------------------
1e3mA2          -GVANVHLDALEHGDTIAFXHSVQDGAASKSYAALAGVPKEVIKRARQKLRELE----------------
1xbtA1          ----------------------------------------------------------------------
3cddA2          GVLLTSDTFGNLVI--------------------------------------------------------
1vplA           RLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLC--DRIALIHNGT----------
2gk3A1          FLLQNETFYQLKIK---PNALESIKEYVKNG---------------------------------------
1fl9A           ----------------------------------------------------------------------
1pv4A3          DANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKXDEVIYEEFKGTGN-------------------
2vnuD1          ----------------------------------------------------------------------
1dhyA1          RIAVQPGELDDLAYAGEVDDAAALERMADKLRQAGVAFTRGDEALMQQ----------------------
1cr0A           DVIILDHI--SIRKMIDNLMTKLKG-FAKSTGVVLVVICHLKD---------------------------
2gx8A1          NKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGHNVEKVMKQVQKQLQEKVDAK----------
1yj5A2          FLEILEIPFRLQEHLDPALQRLY--RQFSEG---------------------------------------
1d6jA           VEAPYEAPANPEVKNYELPVQDAVKQIIDYLDTKGYLPAK------------------------------
1ni3A1          -LSIIVDELLIKDAEFVEKHLEGLRKITSRG---------------------------------------
1l3aA           ---LPDGSGHFFNLSVQNKLINLDENIYIPVTKAEFAVLVSAFN--------------------------
1t3wA           EELIARERTHGLSNEERLELWTLNQELAK-----------------------------------------
1udwA           VRDLFQMKLFVDTDADTRLSRRVLRDISERGRD-LEQILSQYITFPAFEEFCLP----------------
1atrA1          VLRIINEPTAAAIAYGLD----------------------------------------------------
1jjvA           KLTALCDRILVVDVSPQTQLARSAN--FEQIQRIMNSQVSQQE---------------------------
2qgmA1          QYVGLGENTHGSSEIFTXKFRL-VKYLVTEXGFTNFAXEEDWGNGLKL----------------------
1d8jA           KIEVIDGKYAFKPKYNVR----------------------------------------------------
2fggA1          -LDPADEPVAQIGD-----ELAIARALSDLANQ-LFALTSSDIEA-------------------------
1zs3A1          HKFITEDPKAKYWTDEDLLES-----FIVDFQAQNMFITRAIK-----LANKEE----------------
3cddA1          LIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTVTGWRIPQTGKLWNINTLVPV---------------
1np6A           PEELVIDRHVIAVADVPLNLDVALLDINDVEGLADFVVEWMQK---------------------------
1ckvA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1w1wA           YFFVLDEVDAALDITNVQRIAAYIR-RHRNPDLQFIVISLKNT---------------------------
1bs2A1          ----------------------------------------------------------------------
1g6hA           KMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDI--VLNYIDHLYVMFNGQ----------
1b77A2          ----------------------------------------------------------------------
1bgxT2          LVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLY-------------------------
2gtlM1          ----------------------------------------------------------------------
2f9hA1          PTDEDDVIRNGVY------LTPHQLPKITIGTTIDYLV--------------------------------
1afrA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1tmkA           DLTLFLSTQFGDERYETVKFQE---------KVKQTFMKLLDKEI-------------------------
1esmA           ----------------------------------------------------------------------
1f8xA           PTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLN--GIKTNDIMLGVYIPD----------
1v47A1          -ENLATGAFFPVKGFMTREEALSVAHEMRLGEVWTIPILLQFREKPRVPGNTVALLHGGE----------
1j1zA2          NEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVL-----------------
1l7lA           ----------------------------------------------------------------------
1o7d.2          VYLVKDPGGKIVPSDVVTIPSSDSQELLFSALV-------------PAVGFSIYSVSQMPR---------
1odfA           DIFILEGWFLGFNPILQGINDLLTGDM-------------------------------------------
2pa7A1          QEITLDSPAVGLYVGPA--VWHEMHDFSSDCVM-MVLASDYYDET-------------------------
1yvuA2          KGELVRYYLTSYPAFGEKLTEKAIGDVF------------------------------------------
1tueA           ----------------------------------------------------------------------
1iqrA2          ----LREAYRARGGALWVLEEKVPEAARRLKAKA-VYALTSHTPY-------------------------
1ii8.1          SLLILDEPTPYLDEERRRKLITIMERYLKKIPQVIL------------VSHDEELKDAADH---------
1yr6A1          ----------------------------------------------------------------------
1mkyA1          EPI----PVSAEHNINLDTXLETIIKKLEEKG--------------------------------------
1jqjA3          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1sbxA           KRLCLPQILN---SVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVXGILPFSAPSCG----------
1g31A           YVILVSEPAQAGDEEVTSGLIIGKRVQGEVPELVVHSVGPDVPEG-FCEVGDLTSLPVGQ----------
1gm5A1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2yyeA2          GLLFTINKEKLEKIDET-----------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1lw7A2          DVTILLKN--------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1grqA           DGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTH-----------------------------
1g8yA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bs2A1          DFSLLKEPAAKLLIRLLGQYPDVLRNAIKTH-EPTTVVTYLFKLTHQVS---------------------
1g6hA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1em8A           TFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYR-LDEALSFVPHN-----------
2pa7A1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           x
1sgwA           -
1b0uA           -
1m3eA1          -
1q3hA           -
1e69A           -
1ji0A           -
1khbA1          -
1l7vC           -
1e9rA           -
1pf4A1          -
1e6cA           -
1mjgM           -
1g6oA           -
1ex6A           -
1bmfA3          -
1mukA           -
1cd5A           -
1tljA           -
1urjA           -
1f46A           -
1nijA1          -
2yyeA2          -
1jb1A           -
1viaA           -
1c4oA1          -
1qhlA           -
1lw7A2          -
2iqhA1          -
1n25A           -
1ohcA1          -
1ffhA2          -
1jalA1          -
1f2t.1          -
2v3jA1          -
1kgdA           -
1zp6A1          -
1rkbA           -
1ak2A1          -
1jbkA           -
2ancF1          -
2axpA1          -
1qhdA1          -
2vgmA3          -
1s9hA           -
1t06A           -
1poiA           -
1es6A2          -
1e3mA2          -
1xbtA1          -
3cddA2          -
1vplA           -
2gk3A1          -
1fl9A           -
1pv4A3          -
2vnuD1          -
1dhyA1          -
1cr0A           -
2gx8A1          -
1yj5A2          -
1d6jA           -
1ni3A1          -
1l3aA           -
1t3wA           -
1udwA           -
1atrA1          -
1jjvA           -
2qgmA1          -
1d8jA           -
2fggA1          -
1zs3A1          -
3cddA1          -
1np6A           -
1ckvA           -
1grqA           -
1mi8A           -
1g8yA           -
1w1wA           -
1bs2A1          -
1g6hA           -
1b77A2          -
1bgxT2          -
2gtlM1          -
2f9hA1          -
1afrA           -
1l1oA           -
1i1qA           -
1em8A           -
1tmkA           -
1esmA           -
1f8xA           -
1v47A1          -
1j1zA2          -
1l7lA           -
1o7d.2          -
1odfA           -
2pa7A1          -
1yvuA2          -
1tueA           -
1iqrA2          -
1ii8.1          -
1yr6A1          -
1mkyA1          -
1jqjA3          -
1g8fA3          -
1qhbA           -
1xl3C1          -
2bdtA1          -
1sbxA           -
1g31A           -
1gm5A1          -
2gujA1          -
1bifA1          -
1sgwA           -
1b0uA           -
1m3eA1          -
1q3hA           -
1e69A           -
1ji0A           -
1khbA1          -
1l7vC           -
1e9rA           -
1pf4A1          -
1e6cA           -
1mjgM           -
1ex6A           -
1bmfA3          -
1mukA           -
1cd5A           -
1tljA           -
1urjA           -
1f46A           -
1nijA1          -
2yyeA2          -
1jb1A           -
1viaA           -
1c4oA1          -
1qhlA           -
1lw7A2          -
1n25A           -
1ohcA1          -
1ffhA2          -
1jalA1          -
1f2t.1          -
2v3jA1          -
1kgdA           -
1zp6A1          -
1rkbA           -
1ak2A1          -
1jbkA           -
2ancF1          -
2axpA1          -
2vgmA3          -
1s9hA           -
1t06A           -
1poiA           -
1es6A2          -
1e3mA2          -
1xbtA1          -
3cddA2          -
1vplA           -
2gk3A1          -
1fl9A           -
1pv4A3          -
1dhyA1          -
1cr0A           -
1yj5A2          -
1d6jA           -
1ni3A1          -
1l3aA           -
1t3wA           -
1udwA           -
1atrA1          -
1jjvA           -
2qgmA1          -
1d8jA           -
2fggA1          -
1zs3A1          -
3cddA1          -
1np6A           -
1ckvA           -
1grqA           -
1g8yA           -
1w1wA           -
1bs2A1          -
1g6hA           -
1bgxT2          -
2f9hA1          -
1afrA           -
1i1qA           -
1em8A           -
2pa7A1          -
1yr6A1          -
1g31A           -