[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF69275.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gttA1.bssp"
#ERROR : Can't open dsspfile "1nkqA.bssp"
#ERROR : Can't open dsspfile "1sv6A.bssp"
#ERROR : Can't open dsspfile "1hyoA2.bssp"

## Summary of PDB Search
:292
    2e-56  25%  1gttA1 [d.177.1.1] 4-HYDROXYPHENYLACETATE DEGRADATION BIFUNCTIONAL
    3e-47  27%  1nkqA  [d.177.1.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    2e-46  17%  1sv6A  [d.177.1.1] 2-KETO-4-PENTENOATE HYDRATASE
    1e-41  21%  1hyoA2 [d.177.1.1] FUMARYLACETOACETATE HYDROLASE A:119 -- 416
:292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxMQEIGIIDLSQRLGDKYPTLKSLLCANALTDAALWCDEPADYYYQEVTFLPVID
1gttA1          ----------------------------------------------------------------------
1nkqA           ------------------------------------------------------------------NYLK
1sv6A           ----------------MTKHTLEQLAADLRRAAEQGEAIA---PLRDLIGIDNAEAAYAIQHINVQHDVA
1hyoA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DPQKIICVGMNYADKRIEFNETNPAPTLFVRFADSQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVS
1gttA1          -KGTIFAVALNHRSQLDAWQEAFQQAVWFIKPRNTVIGCGEPIPFPQGEK-VLSGATVALIVGKTATKVR
1nkqA           AARKIICIGRNYAAHIKELNN---QPFFFLKPTSSIVTPNPGPIFIPRGVKVHHEIELALIVSKHLSNVT
1sv6A           QGRRVVKVGLTHPKVQQQLG--VDQPDFGTLFADMCYGDNEIIPFSRVL-QPRIEAEIALVLNRPATDIT
1hyoA2          --QHATNVGIMFRGKENALLPNWLHPVGYHGRASSIVVSGTPIRRPMGCRLLDMELEMAFFVGRFGEPIP


                         +         .         .         .         .         *         .:210
query           AEDALDYVAGYSCYMDGSVRDWQHSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNES
1gttA1          EEDAAEYIAGYALANDVSLPEESYRPAIKAKCRDGFCPIGETVAL----SNVDNLTIYTEINGRPADHWN
1nkqA           PEEVYDSISGVALALDLTARNVQDEAWTISKGFDTFXPISAIVSREKFSSYKSIFRVKCSVNGQLRQDGG
1sv6A           FDELYNAIEWVLPALEVVGSRIRDWSIQFVDTVAGVYVIGGPAQRPAGL-DLKNCAMKMTRNNEEVSSGR
1hyoA2          ISKAHEHIFGMVLMNDWSARDIQPLGPFLGKSFG--TTISPWVVPMDALPYTFDINLSVSLKGEGMSQAA


                         .         .         .         +         .         .         .:280
query           TANMIHPIASLIAYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRY
1gttA1          TADLQRNAAQLLSALSEFATLNPGDAILLGTPQARV-------EIQPGDRVRVLAEGFPPLENPVVDERE
1nkqA           TNLXLHPLHKILQHISTXISLEPGDIILTGTPAGVG-------ELKPGDRVHCELLQNNDNIV-------
1sv6A           GSECLGHPLNAAVWLARKEPLRTGDIILTGALGPMV-------AVNAGDRFEAHIEGIGSVAATF-----
1hyoA2          TKHMYWTMLQLTHHSVNGCNLRPGDLLASGTISGSD-------PESFGSMLELSWKGTKAIDVGQGQTR-


                         .         *         .         .         .         .         +:350
query           LTSxxxxxxxxx
1gttA1          VTT---------
1nkqA           ------------
1sv6A           ------------
1hyoA2          ------------