[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF69484.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"
#ERROR : Can't open dsspfile "1rz3A.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"
#ERROR : Can't open dsspfile "1tzbA.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1qvrA2.bssp"
#ERROR : Can't open dsspfile "1sfjA.bssp"
#ERROR : Can't open dsspfile "1wr8A.bssp"
#ERROR : Can't open dsspfile "1dg3A2.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1tf7A1.bssp"

## Summary of PDB Search
:648
    1e-42  34%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    6e-40  20%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    2e-36  23%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    3e-36  24%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-33  26%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    2e-32  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    4e-32  25%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    5e-32  13%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    1e-31   6%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    9e-31  13%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-29  10%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    1e-28  11%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    5e-27   7%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    7e-27  11%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    2e-26  10%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    5e-26  11%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    1e-25   9%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    2e-24  10%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    1e-23  10%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    1e-23  29%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    3e-23  17%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    6e-23  10%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    8e-23  13%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    3e-22   8%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    4e-22  13%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-21  10%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    1e-21  11%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    6e-21  11%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    9e-21   6%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    9e-21  14%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-20  27%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    3e-20  12%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    3e-20  20%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    1e-19  10%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    2e-19  10%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    2e-19  10%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    2e-19  15%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    3e-19  10%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    3e-19  10%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    4e-19  16%  1jbkA  [c.37.1.20] CLPB PROTEIN
    5e-19  12%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    6e-19  13%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-18   8%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    2e-18  12%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-18  10%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    3e-18  15%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    3e-18   9%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    7e-18  26%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-17   9%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    1e-17  11%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    2e-17  12%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    2e-17   9%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    6e-17   9%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    7e-17  10%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    1e-16   8%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    1e-16  13%  1t3wA  [a.236.1.1] DNA PRIMASE
    3e-16  11%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    5e-16  12%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    5e-16  12%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    6e-16  10%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    7e-16   9%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    8e-16  10%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    9e-16   9%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    1e-15   6%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    1e-15  24%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-15   7%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    2e-15   9%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    3e-15  11%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    3e-15   9%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    5e-15  14%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    6e-15  15%  1jb1A  [c.91.1.2] HPRK PROTEIN
    7e-15  14%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    1e-14  16%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-14  11%  1g6oA  [c.37.1.11] CAG-ALPHA
    2e-14  27%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    3e-14  15%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    3e-14   8%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    3e-14  11%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    4e-14  12%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    7e-14   9%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    1e-13   7%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    2e-13  11%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    3e-13   6%  1mi8A  [b.86.1.2] DNAB INTEIN
    4e-13  11%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    5e-13  12%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    5e-13  10%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    6e-13  12%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-12   7%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    3e-12  12%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    5e-12   7%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    6e-12   7%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    8e-12  12%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    8e-12  11%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    1e-11  13%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    2e-11  15%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    2e-11  11%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    3e-11  13%  1sbxA  [a.6.1.4] SKI ONCOGENE
    4e-11  10%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    4e-11  10%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    5e-11   9%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    9e-11  20%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    1e-10  13%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    2e-10  17%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-10   8%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    2e-10   8%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    2e-10   9%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    3e-10  12%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    7e-10  21%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    1e-09   6%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    3e-09  14%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    3e-08  10%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    3e-08   7%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    4e-08  14%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    5e-08  10%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    6e-08  12%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    8e-08  21%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    9e-08  16%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    1e-07  13%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    2e-07  12%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    2e-07  12%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    3e-07  15%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    3e-07  10%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    4e-07  10%  1oa8A  [b.145.1.1] ATAXIN-1
    4e-07  20%  1g31A  [b.35.1.1] GP31
    6e-07   8%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    1e-06  29%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    5e-06  14%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    9e-06  25%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    1e-05   5%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    2e-05  12%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    3e-05  18%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
    4e-05  34%  1rz3A  [c.37.1.6] HYPOTHETICAL PROTEIN RBSTP0775
    5e-05  12%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    1e-04  32%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
    2e-04  16%  1tzbA  [c.80.1.1] GLUCOSE-6-PHOSPHATE ISOMERASE, CONJECTURAL
    2e-04  33%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    2e-04  38%  1qvrA2 [c.37.1.20] CLPB PROTEIN A:149 -- 535[MASQUE : MEMB(X) 0 /
    3e-04  17%  1sfjA  [c.1.10.1] 3-DEHYDROQUINATE DEHYDRATASE
    3e-04  24%  1wr8A  [c.108.1.10] PHOSPHOGLYCOLATE PHOSPHATASE
    5e-04  43%  1dg3A2 [c.37.1.8] PROTEIN (INTERFERON-INDUCED GUANYLATE-BINDING
    7e-04  44%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 --
    0.001  14%  1tf7A1 [c.37.1.11] KAIC A:14 -- 255
:648

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR
1b0uA           ---KLHVIDLHKRYGG----HEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQ
1sgwA           --SKLEIRDLSVGYDK-----PVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGV
1ji0A           ---VLEVQSLHVYYGA----IHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQ
1q3hA           ---LEKVSFSHLCLVGNP----VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR
1pf4A1          VNGEVDVKDVTFTYQGKEKPA--LSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGH
1e69A           ----------------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSE
1l7vC           -SIVXQLQDVAEST--------RLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAG-XTSGKGSIQFAGQ
1m3eA1          --------------------YTDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNA
2yyeA2          ------------------------------AQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENML
1ex6A           ----------------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTT
1urjA           --HETTGEALCERLGLDPDRLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDF
1e9rA           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
1khbA1          ----------------------LVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIA
1mukA           ---MDETLMRARRHSYS--SFSKLLEAYLLVKW-----RMCEAREPSVDLLPLCAGID-PLNSDPFLKMV
1pv4A3          -----LFENLTPLHANTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVL
1nijA1          ---------------------------------IAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEF
2gtlM1          HAIVTITAAHRKSFFPNRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYGVI-CD
1bmfA3          APGIIPRISVREPMQTGI----KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKK
2v3jA1          ----------------------APPVLTSKDKITKRXIVVLAXASLETHKIYVLLNC-DDHQGLLKKXGR
2gujA1          ------------------------------------------VKKGSDPYFTLQAVLDDQSSGTERVTLY
1ffhA2          ------------------------EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAA
2gx8A1          -----------------------------------DAGAGHIGNYSHCTFSSEGTGTFVPQQLE-RVEEV
1jalA1          ---------------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVV
1kgdA           -------------------------------HMRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTT
1jjvA           ---------------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDA-DVVAR
1qhlA           ----GKFRSLTLIN------WNGFFARTFDLD-ELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKL
1tljA           ----------------------ALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYT-QSSCSGRITIVDA
1n25A           -----------------SVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLD
1t06A           -----------------------VMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQE-
1ni3A1          ------------------------KVQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATI
1f2t.1          ----------------------------------------------------------------------
1grqA           --------------------------------TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSL
1bgxT2          --------------------------------------------------MRGMLPLFEPKGRVLLVDGH
1c4oA1          -----RYRGPSPKGD----QPKAIAGLVEALRDGERVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKI
1ohcA1          ----------------------------------------------------------RDPQDDVYLDIT
1f46A           ------------------------------------------------IIMNVAAHHGSELNGELLLNSI
1lw7A2          ----------------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREF
1zp6A1          --------------------------------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDL
1mjgM           ----IKLTKIKLDLPI----NFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGP-
1jbkA           ----ERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGR
1xbtA1          ---------------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKY
1d6jA           --------------------LTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLD
2iqhA1          LYDKEEIRRIWRQANNGDDATAMIWHSNLNDATYQRTRALV-RTGMDPRMCSLMQGSTLPRRSG--AAGA
1rkbA           ------------------------------LMLLPNILLTGTPGVGKTTLGKELASKSGLKYINV-----
1e6cA           ----------------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQ
1bs2A1          ----------------------------------------------------------------------
1cd5A           ----VSFKHVVTFNMDE---YVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEE
1vplA           ----VVVKDLRKRIGKKE----ILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGK
1udwA           ---------------------------------PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSF
1poiA           --------------------MTLKDAIAKYVHSGDHIALGGFTTDRYAAVFEILRQGITDLTGLGGAAGG
2axpA1          -----------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFEL
1s9hA           ----------------------FLGWATKKFGKRNTIWLFGPATTGKTNIAEAI-------AHTVPFYGC
1i1qA           LTKVDRYSYVMHLVSRVVGEL--RHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSY-----
1ak2A1          ---------------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLR
1qhdA1          ----------------------YIENWNLQNRRQRTSVLADASETMLANVTS-VRQEYAIPVGPVFPPGM
1t3wA           ----------------------------------------------KRTTXRILIGLQNPELATLVPPLE
1o7d.2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1fl9A           LTQYIPDEFSMLRFG----KKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYT
3cddA2          ---VLKAGGKIYQGWTKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVIT
1e3mA2          ---GIRITEGRHPVVEQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQ
2qgmA1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1g6hA           --EILRTENIVKYFGE----FKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENK
1j1zA2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1np6A           ---------------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKH
1zs3A1          ----------------------------------------------------------------------
1atrA1          ------------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTE
1jb1A           -------------------ERRSXHGVLVDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVY
1cr0A           ----------------------GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG-KKVGLA
1ii8.1          ----------------------------------------------------------------------
1g6oA           -------FEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDT
2fggA1          ----------------------------------------------------------------------
1ckvA           MSVNSNAYMGLKGKDFADQ---FFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVYWWIKAN
1es6A2          ----------------------------------------------------------------------
1viaA           ----------------------------------KNIVFIGFXGSGKSTLARLAKDLDLVFLDSDFL-IE
1tmkA           ---------------------------------GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPER
1l3aA           ----------------------------------------------------------KVFVGYSIYKGK
1l7lA           ---------------------AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDRE
1v37A           ----------------------------------------------------------------------
1mi8A           ---RVSIKDLLDEKDFE---IWAINEQTMKLESAK-VSRVFMTGKKLVYILKTRLGRTIKATANHRFLTI
1dhyA1          ----------------------------------------------------------------------
1esmA           ---LSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELI
2pa7A1          ----------------------------------------------------------------------
1g8yA           --ATHKPINILEAFAAAPP---PLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGEL
1ovmA2          LDHVIDSPDICWVGCANE--LNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGA
2vnuD1          ---RIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHDVEYR--------
3cddA1          ----------------------------------------------------------------------
1afrA           --------------------REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDP
2je6I3          -------------------------GIVIDIMPVKVPRVIGKNKSMYETLTSK--SIFVANNGRIWAFSE
2ancF1          ---------------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQV
1yj5A2          ----------------------------------EVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGS
1mm8A           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          -----------------------VASVITEIKAEDLQQLL-----RVSRGLQIDTIAITNKDGKIVINGY
1em8A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1w1wA           ---------------------------------SNFTSIIGPNGSGKSNMMDLMRIISRNGDTSYKIDGK
1dnpA2          ----------------------------------------------------------------------
1jqjA3          ----LEAGCDLLKQAFARAAAAKFRGVRLYVSENQLKITANNPEQEEAEEIL-----------DVTYSGA
1yvuA2          ----------------------------------------------------------------------
1l1oA           ----------------------RINAGMLAQFIDKPVCFVGRLEKIHPTGKMF--ILSDGEGKNGTIELM
1q3tA           ---------------------------------TIQIAIDGPASSGKSTVAKIIGFTYLDTGAMYRAATY
1g8fA3          ------------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIF
1d8jA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1yr6A1          ------------------------------------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLD
1ckeA           ---------------------------------APVITIDGPSGAGKGTLCKAMAEWHLLDSGAYRVLAH
1dwmA           ----------------------------------------------------------------------
1mkyA1          ------------------------------------VLIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTF
1tueA           ---FLRYQQIEFIT-----FLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISF-----
1t9hA2          ----------------------DSLADIIPHFQDKTTVFAGQSGVGKSSLLNAISPRHVELIHTSGGLVA
1e2hA           ---------------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRV
1a4iA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1pgsA2          -----SIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNA
1j90A           ------------------------------------VLIEGNIGSGKTTYLNHFCLLTEPVEKWRNVNGV
1jqjA2          ----------------------------------------------------------------------
1p5zB           ---------------------------------IKKISIEGNIAAGKSTFVNILDWEVVPEPVARWCNVQ
1puoA2          ----------------------------------------------------------------------
1odfA           -----------------DKYIPEWFETGNK--CPLFIFFSGPQGSGKSFTSIQIYSIGYASIDDFYLTHE
1oftA           --------------------------------AAFSELSLSGLPGHCLTLAPILRELSEEQDA-----RW
1rz3A           -----------------------------------VLGIDGLSRSGKTTLANQL-------SQTLREQGI
1iioA           ----------------------------------------------------------------------
1tpzA           ------------------------------------VAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVV
1tzbA           ----------------------------------------------------------------------
4tmkA           ---------------------------------SKYIVIEGLEGAGKTTARNVV----------------
1qvrA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1dg3A2          -----------------PEALKILSAITQPM---VVVAIVGLYRTGKSYLMNKLA-GKKHTKG-------
1lnzA2          ------------------------------------VGLVGFPSVGKSTLLSVV----------------
1tf7A1          ------------------------------LPIGRSTLVSGTSGTGKTLFSILYNGIIEFDEPGVFVTFE


                         .         .         *         .         .         .         .:140
query           DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDY
1b0uA           NINLVRDKDGQLKVADRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGERAQGK
1sgwA           PITKVKG---------KIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALESVEV---LDLKK
1ji0A           DITNKPAH---VINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQ
1q3hA           VSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITK--------------FAEQDNTVLGE
1pf4A1          DVRDYKLTNLRRHFALVSQNVHLFNDTANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGE
1e69A           NLPPAGSAYVELVFEENGEEITVAREGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQ
1l7vC           PLEAWSATKL----ALHRAYLSQQQTPPFATPVWHYLTLH-----QHDKTRTELLNDVAGALALDDKLGR
1m3eA1          GVDNFGLGLLLQSKQIKISSYVGENAEFERQYLAGELEVELTPQGTRIRAGGAGVPAFYTSTGYGTLVQE
2yyeA2          ALNDKARNLMLSLDATACTDVTGFLGHAWNICKNSNIGARIFFEKVYQLSENLVKKKIYPKGAIENLNFV
1ex6A           RTPRAG-------EVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDID
1urjA           SRVIAEP-FNANHRSIGEKFTYPLPFFNRPLNRLEAVVGPAAVAAVARAAAHLAFDENHEGAALPADITF
1e9rA           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL
1khbA1          WMKFDAQGHLR--AINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASGV
1mukA           SVG----PMLQSTRK-YFAQTLFMAKTVSGLDVNAIDSA-LLRLRTLGADKKALTAQLLMVGLQESEADA
1pv4A3          LIDERPEEVTEXQRLVKGEVVASTFDEPASRHVQVAEXVIEKAKRLVEHKK--------------DVIIL
1nijA1          GEVSVDDQL----IGDRATQIKTLTNGCICCSRSNELE----DALLDLLDNLDKGNIQFDRLVIECTGMA
2gtlM1          FNLGDDDHADCKIVVPSSLFVCAHFNAQRY----------------------------------------
1bmfA3          LYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAPLQYLAPYSGCSMGEYFRDNGKHALIIYD
2v3jA1          DISEARPDITHQCLLTLLDSPINKAG---KLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLS
2gujA1          DV-NFDSAKIASLDEEEVPFTFEDFDVPEKL---------------------------------------
1ffhA2          DTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKAR---------------------LEARDL
2gx8A1          RIETIIPASLRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIG---YLQEEMTLGQFAEHVKQSLDV
1jalA1          PMPDPRLDA----LAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENI
1kgdA           RPPEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLET------------IRKIHEQGLIAILD
1jjvA           EVVAKDSP-----LLSKIVEHFGAQILNRAALRERVFNHDEDK-------------LWLNNLLHPAIRER
1qhlA           KA---------GVCYSMLDTINSRHQRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKD
1tljA           EMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLI---VQGPIIHIYAKNIETGWDILKIAREAGF
1n25A           RLNFELGVAIDQFLVDVKGTGGESRDLPSGQGINNLDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYS
1t06A           -----LAEELYATGNYDAMYFAGIIADPKAMSESDFDRWIDGAYFYMLSDYVVAVTLSESNIA--QDVAD
1ni3A1          DP-EEAKVAVPDERFDWLCEAYKPKSRVPAFL--TVFDIAGLTKGA--STGVGLGNAFLSHVRAVDAIYQ
1f2t.1          -----------------------------------------------------------------EGKER
1grqA           IEAMPLKMQSAE------GGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQE
1bgxT2          ------------------HLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFSFRHEA
1c4oA1          LAAQLAAEFRELFPENAVEYFISYYDYYQP--EAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDV
1ohcA1          DRLCFA--ILYSRPKSASNVHYFSDNELEYENFYAD--FGPLNLAMVYRYCCKINKKLKSITMLRKK---
1f46A           ---------------QQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVFMQVP
1lw7A2          VFEKLGGDEQAMQYSDYPQXALGHQRYIDYAVRHSHKIAFIDT---------------------DFITTQ
1zp6A1          WGYIKHGRIDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTT
1mjgM           -----DIDQIPEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQRNINWL--RVSKDA
1jbkA           RVLALDMGALVAGAKYRGEFEERLKGVLND-LAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHC
1xbtA1          AKDTRALP---ACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAM---------ANAGKTVIVAALDGT
1d6jA           GDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDR-------------DTARQ
2iqhA1          AVKGVGTM--VMELIRMIKRGINRRTRIAYERMCNILKGKFAAQRTMVDQVRESRNPGNAEFEDLIFLAR
1rkbA           GDLAREEQLYDGYDE-EYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVTR
1e6cA           HTSGMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPQASLQ
1bs2A1          -----------------------------------------------------------------PYLQY
1cd5A           KLFMGGVGNDGHIAFNEPASSLASRTRIKSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALA
1vplA           NVVEEPHE-----VRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKD
1udwA           YRVLTSEQ---KAKALKGQFNFDHPDAFDNELILKTLKEITEGKTV----------QIPVYDFVSHSRKE
1poiA           DWDMLIGNGR--VKAYINCYTANSGVTNVSRRFRKWFDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTD
2axpA1          AKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRG
1s9hA           VNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAI----LGGSKVRVDQKCKSSAQIDPTPVIVTSNT
1i1qA           --------------GGAVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGIVLDSVPQSEADETRNK---
1ak2A1          AMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEK
1qhdA1          NWTDLIT------NYSPSREDNL-QRVFTVASIRSML---------------------------------
1t3wA           NLDENKL-----------PGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSXWDDIADKNIA
1o7d.2          --------------------------------------------------------------------RF
2f9hA1          ---------VTEIGK-HAIDDSEKXIILFGETATDTLKQHAVIQSFPEKDQVTLAEGDHLKIGDTNYTIT
2vgmA3          -----------------------------------------------------------------LHLNK
1fl9A           LVEEYNIAGKM--IYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDA
3cddA2          GYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPF
1e3mA2          KV--------------EIGPIDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWA
2qgmA1          -----------------------------------------------------------------SQANP
2gk3A1          ------------------KVLFIGESWHIHXIHSKGYDSFTSSKYEEGATWLLECLRKGGVDIDYTVQIA
1g6hA           DITNKEPA---ELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPIPKEEEMVEKAFKILEFLKLSHLYDR
1j1zA2          -------------MDA--NLLHISYEGGVLEDPWAEPPKGMF-----RMTQDPEEAPDAPEYVEVEFFEG
1f8xA           -----------------------------------------------------------------KTIYF
1np6A           THHELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSK--------------------LDLI
1zs3A1          ---MIDEKYAKELDK---AEIDHHKPTAGAMLVLSNLFIENIRLAGIYAKSPVKCEYLREIAQREVEYFF
1atrA1          RLIGDAAKNQVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNA
1jb1A           QQDEQTIVG-------AAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTISLIVHLENWTPDQ-LIFDV
1cr0A           ML-EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDEL----------------FGNDTFHL
1ii8.1          -----------LIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKER
1g6oA           EEIVFKHHKNYTQLFFGGNITS-------ADCLKSCLRXRPDRIILGELRSSEAYDFYNVLCSGHKGLTT
2fggA1          -----------------------------------------------------------------DERTR
1ckvA           GKIEVDCDEI----SELLGRQFNVYDFLVDVS--------------------------------------
1es6A2          --------------------------LRPGISFHPKLRPILLPNKNSADLTSPEKIQAIMTSLQKIVPID
1viaA           QKFNQKVSEIFEQKR-ENFFREQEQKXADFFSSCEKACIATGGGAGFCIYLKADFEYLKKRLDKDEISKR
1tmkA           STRIGGLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLL--------EGKNIVMDRYVYSGVAYS
1l3aA           AALTVEP-----RSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSITKDSCE
1l7lA           HPDQGLIC-----HDAFCGALVMKI----GNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGT------
1v37A           ------------------------------------------------------------------RLYP
1mi8A           DGWKRLD----ELSLKEHIALPRKSDISWDSIVSITETGVEEVFDL------------------------
1dhyA1          -----------------------------------------------------------------HFLTK
1esmA           TTDGFLHPNQVLKERGLXKKKGFPESYDXHRLVKFVSDLK------------------------SGVPNV
2pa7A1          -----------------------------------------------------------------KKLEQ
1g8yA           PTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLI------------------GSLPNI
1ovmA2          PGTAAQQR------GELLHHTLGDGEFRHFYHMSEPITVAQAVLT-------------------------
2vnuD1          ----------------------------------------------------------------------
3cddA1          -----------------------------------------------------------------SWRQR
1afrA           A---------------------------------------------------------------------
2je6I3          EILIEAIRKIENESH-------------------------------------------------------
2ancF1          LATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYVN
1yj5A2          WQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSH
1mm8A           --------------------VFSSAALGDPRRTARLVNVAAQLASITISSEGSKAAQEGAYRFIRNPNVS
1bccF           -------RWLEGIRKWYYNAGFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQQI
1sbxA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1gm5A1          -----------------------TSSLFLWGEALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKELDDPLL
1b77A2          NKVEDSGL---TRPKYSLTLTDYDGSNNNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYVIME
1em8A           ----------------------------------------------------------------------
1vhhA           ------------------------------------------------------------------SGRY
1w1wA           TVSYKDYSIFLELIKAKNFLVFQGDVEQIAAQSPVELSRMFTFDYVSDHLDAIYRELTGNASLTKYHAT-
1dnpA2          ------------------------VWFRQDLRLHDNLALAAACRNSSARVLAL-----------YIATPR
1jqjA3          EMEIGFNV---SYVLDVLNALKCENVRM-MLTDSVSSVQI------------------------------
1yvuA2          ----------------------------------------------------------------------
1l1oA           EPLDEEISG----IVEVVGRVTAKATI-------------------------------------------
1q3tA           MALKNQLGVLALLD--QHPISFGRSETGDQLVFVGDV---DITHPIRENEVTNHVSAIAAIPEVREKLVS
1g8fA3          EHNNKTELLSLIQDFIGSGSGLIIPDQWEDDKDSVVGKQ-------------------------------
1d8jA           -----------------------------------------------------------------DEILD
1iqrA2          -----------------------------------------------------------------GLVVL
1zbsA1          -----------------------------------------------------------------YILGD
1xl3C1          -----------------------------------------------------------------RMFRL
1uouA3          ----------------------------------------------------------------------
1yr6A1          TGVKELP---YEPSIDVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTP
1ckeA           HVDVASEDALVPLAS-HLDVRFVSTNGNLEV----ILEGEDVSGEIRTQEVANAASQVAAFPRVREALLR
1dwmA           ----------------------------------------------------------------------
1mkyA1          KLVDTCGVF--DNPQDIISQKXKEVTLNXI--READLVLFVVDGKRGITKEDESLADFLRKSTVDTILVA
1tueA           ----------------------------------------------------------------------
1t9hA2          DTPGFSSLEFTDIEEEELGYTFPDIREKSSSCKFRGCLHLK--------EPKCAVKQAVEDGELKQYRYD
1e2hA           LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQ-----------------------------------
1a4iA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------SHSPGV
1g31A           ----------------------------------------------------------------------
1pgsA2          NTFQHQLGALGCSANPINNQSP------------------------------------------------
1j90A           -----NLLELMYKDPKKWAMPFQSYVTLTMLQSHTA----------------------------------
1jqjA2          ----------------------------------------------------------------------
1p5zB           STNGGNVLQMMYEKPERWSFTFQTYACLSRI---------------------------------------
1puoA2          ------IFYDVFFAVANGNELLLDLSLTVNATEPERTAMKKIQDCY------------------------
1odfA           DQLKLKNNKLLQGRGLPGTHDMKLLQVLNTIFNQDTVVLP-KY---------------------------
1oftA           LTLIAPPASLTHEWLRRAGLNRERILLLQAKDNAAALAL-------------------------------
1rz3A           SVCVFHXDIVERAKRYHTGVEWLTHQLFRQLKASHQLTLP------------------------------
1iioA           ----------------------------------------------------------------------
1tpzA           EVTM------------------------------------------------------------------
1tzbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1dg3A2          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1tf7A1          E----TPQDIIK-NARSFGWDLAKLVDEGKLFILDASPDPEGQEVV------------------------


                         +         .         .         .         .         *         .:210
query           PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQA
1b0uA           YPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHS
1sgwA           KLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEIKEKGIVIISSREEL---SYC
1ji0A           LGGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKA
1q3hA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1pf4A1          NGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDE-LQKNKTVLVIAHRLSTIEQA
1e69A           KLSLLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENS-KHTQFIVITHNKIVMEAA
1l7vC           STNQLSGGEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLHTLRHA
1m3eA1          GGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKAD-QAGNVTFRKSARAETTVVEV
2yyeA2          KNYLKSNLDNWKLILLSDPVTSGGLLFTINKEKL------EKIDETAKELEVNYWIIGETIAENVLE---
1ex6A           MQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAEAHDKVIVNDDLKAYKEL
1urjA           TAFAGGFEQRLASVMAGDAALALMAVFDEPPTDISAQDTAAARANAVGAYLARAAGLVGAMVFSTNSALH
1e9rA           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDKLPEHVTM
1khbA1          TITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALS-W
1mukA           LAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLTDIPPRMGWLRA--------
1pv4A3          LDSITRLARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVE-----EGGSLTIIATALIDTGSKDEVIY
1nijA1          DPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMN---QFTIAQSQVGYADRILLTKTDVAEAEKLH
2gtlM1          ----------------------------------------------------------------------
1bmfA3          DLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIP
2v3jA1          IRSEEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEK-----LDDDESICVFVGAKDNFADEYV
2gujA1          ----------------------------------------------------------------------
1ffhA2          ILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFEKVGVTGLVLTKLDGDARGA
2gx8A1          KGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDMMLGLNIVDPGHNVMKQGVQ
1jalA1          DPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKIPVLENAGMIRSVGLDKEELQI
1kgdA           VEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAH-YFDLTIINNEIETIRHL
1jjvA           MKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSP-QTQLARSANFEQIQRIMNSQVSQQERLKWA
1qhlA           KLEAMTDYHSLMFDLLRSASDRSKFYRLIEASGGISSAITRSLRDYLL----------------------
1tljA           KHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKDLL-----
1n25A           VPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLLIWYRPVAEFAQSIQSRIVEWKERD
1t06A           KWIASGDELKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPETKSAMNNFLNTVAISYKAVEIA
1ni3A1          VVRAFDDAEIIHVEGDVDPIR--DLSIIVDELLIKDAEFVEKHLEGLRKITSRG----------------
1f2t.1          PLTFLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAA
1grqA           RWRSFVGDLDVLWVGVRC-----DGAVAEGRETARGDRVAGMAAKQAYVVHGVEYDVEVDTTHKESIECA
1bgxT2          YGGYKAGRAPTPEDFPRQLALIKELDLLGLARLEVPGYEADDVLASLAKKEKEGYEVRILTADKLYQLLS
1c4oA1          IVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEV------
1ohcA1          IVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDCNFYITLLDCFHAVKKAMQ-
1f46A           SYGDELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN----------------
1lw7A2          AFCIQYEGKAHPFLDSXIKEYPFDVTILLKNNKLLDKYKVPYIEIESPSYLDRYNQVKAVIEKVLNEEEI
1zp6A1          AAEA---IERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQSGRFR---
1mjgM           VAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKEDRMRGLTDETVDTFYSC
1jbkA           VGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDT-------IAILR----------------------
1xbtA1          FQRKPFGAILNLVPLAESVV--------------------------------------------------
1d6jA           LHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVQIIDYLDTKG---YLPAK--------
2iqhA1          SALILRGSVAHKSCLPACVYGSAVASGYDFEREGYS------LVGIDPFRLLQNSQVYSLIRPNNPAHKS
1rkbA           GYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKW-IEQWIKDH--------
1e6cA           AHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDTQPPAAIVCLMQTMR-------------------
1bs2A1          AHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLT--H
1cd5A           LQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKG----------------
1vplA           RVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNLEVEFLC
1udwA           ETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKA
1poiA           EWGISKEVRKTLDKVPDDKFKYIDNFKPGEKVVAVPVPQVDVAIIHAQQASPDGTVRIGKFQDVDIAEAA
2axpA1          DEYIEGKDIDSILELYREVXSNAGLHTYSWDTGQWS---SDEIAKDIIFL--------------------
1s9hA           NMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKTKQEVKDFFRWAKDHVVEVEHEFYVK------
1i1qA           -----ARAVLRAIATAH-----------------------------------------------------
1ak2A1          LDSVIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKGIHSAIDASQTPVVFASI
1qhdA1          ----------------------------------------------------------------------
1t3wA           E---QTFTDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQELA-------------------
1o7d.2          QVIVYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQEL-LFSALVPAVGFSIYSVSQM
2f9hA1          KVGSFANSNLQSIAHSTLIFA-------DAPTDEDDVIRNGVYLTPHQLPITIGTTIDYL----------
2vgmA3          DDDKAWYGEK-EVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEED
1fl9A           RNIELIAQTNLGKNIISAF---------------------------------------------------
3cddA2          QRIQIEQGETPHELLARLAKQ-RGVLLTSDTFGNLV----------------------------------
1e3mA2          CAENLANKIKALTLFATQLPEKXEGVANVHLDALEHGDTIAFXHSVQDGAASKGLAVAGVPKEVIKRARL
2qgmA1          LKTIEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKL
2gk3A1          FPESIDELNRYDVIVISDIGSNTFLLQNETFYQLKIKP---NALESIKEYVKNGGGLLIEAKANYKNTVL
1g6hA           KAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLIVLNYI
1j1zA2          DPVAVNGERLSPAALLQRLN----EIGGRHGVGRVDIVENRFVGMKSRGVYETPGTILYHARRAVESLTD
1f8xA           GAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRDEHPEYLHDKVWATATYNNDLNGIKTN
1np6A           LVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDLNLDVALLDINDVEGLADFVVEWM-------
1zs3A1          KISDLLLDENEIVPSTTEEFLKYHKFITEDPKAKYWTDE-DLLESFIVDFQAQNMFIIKLANKEEKFALA
1atrA1          VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYG-------------------------------
1jb1A           PVPKITVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIE--------------------------
1cr0A           YDSFAEAETDRLLAKLAYMRSGCDVIILDHIS--IRKMIDNLMTKLKGFAKSTGVVLVVICHLRALRQLS
1ii8.1          PLERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAA
1g6oA           LHAGSSEEAFIRLSSNSAARNIKFESLIEGFKDLID--------XIVHINHHKQCDEFYI----------
2fggA1          AKARLSWAGRQXVGVGLARLD-----PADEPVAQIG-----DELAIARALSDLANQLFALTSSDIEAS--
1ckvA           ----------------------------------------------------------------------
1es6A2          PTKNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL----------
1viaA           PLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDELL-SEIKKVIK----------------------
1tmkA           AAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQ-------EKVKQTFMKLLDKEIRKGD
1l3aA           FFHDPNKGRSDEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDENIYTKAEFAVLVSA--------
1l7lA           -YGNNSGSFSVNIGKDQS----------------------------------------------------
1v37A           ELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRLEGLKAPAVLFTHGGVVRAVL
1mi8A           ----------------------------------------------------------------------
1dhyA1          SVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAARMADKLRQAGVAFTRGDEA-LMQ
1esmA           TAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSYVDAPEDLLQTWYI
2pa7A1          VLVCLNGSCRVILDDGNII----QEITLDSPAVGLYVG--PAVWHEMHDFSSDCVMMVLASDYYDETDYR
1g8yA           MAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASG-PMAQVIGRMEAIAADTGCSIVFLHHAVLVDNIQ
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
3cddA1          FSKFTIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSAEYTVTGWRIPQTGKLWNI
1afrA           ----------SFQERATFISHGNTARQAKEHGDIKLAQICGTIA------ADEKRHETAYTKIVEKLFED
2je6I3          ----------------------------------------------------------------------
2ancF1          DDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA---------------------------------
1yj5A2          APVSDXVXFSYRKQFEPPTLAEGFLEILEIPFRLQEHLD-PALQRLYRQFSE------------------
1mm8A           AEAIRKAGAMQTVKLAQEF----PELLAIEDTTSLSYRHQVAEE-LGKLGSIQDKSRGWWVHSVLLLEAT
1bccF           LPKE---QWTKYEEDVPYLEPYLKEVI-------------------------------------------
1sbxA           -PSDRSTERCETETISCFVVGGEKRLCLPQILNSVLRD--FSLQQINAVCDELHIYCSRCTADQLEILKV
1v47A1          ----------PALEIGEDERLDLENLA-TGAFFPVKGFMTREEALSVARLPTGEVWTIPILLQFREKPPG
1gm5A1          ENKDLEEKLQAFLDYVKEIPN------LPEARKRYRIQKSLEMIEKLRSW---FLIDYL-----------
1b77A2          ADSTHD----------------------------------------------------------------
1em8A           -----------------------TFYLLDNDTTVDGLSAVEQLVEIAAERWRSGKRVLIACEDEQAYRLD
1vhhA           EGKITRNSERFKELTPNYNPD---IIFKDEENTGADRLMTQRCKDKLNALAISPGVKLRVTEGWDEDGHH
1w1wA           PPEYLSGGEKTVAALALLFYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKS
1dnpA2          QWATHNMSPRQAELINAQNGLQIALAEKGIPLLFREVDDFVASVEIVQVCAENSVTHLFYNYQYVNERAR
1jqjA3          ----------------------------------------------------------------------
1yvuA2          -----TRDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGDV--------FSLLEKLGFKKG
1l1oA           ----------------------------------------------------------------------
1q3tA           LQQEI-AQQGGIVMDGRDI---GTVVLPQAELKILVASVDERAERRYKENIAKG---IETDLETLKKEIA
1g8fA3          ----------------------------------------------------------------------
1d8jA           ETQHLDIGLKQKQWLMTEALNNPKIEVIDGKYAFKPKYN-------------------------------
1iqrA2          DPNNLKTTPRRRAWFLENVRA------LREAYRARGGALWVLEGLPWEAARRLKAKAVYALTSHPYGRYR
1zbsA1          EGSGAVLGRLFIGSLLKGQX---PEGLCEAFLQEYGLTSADIIESVYRK-PFPNRFLAGFSPFIAQHLDI
1xl3C1          FPLGVFSDEEQRQNLLQMCQNAIDMAIESE----------------------------------------
1uouA3          ----------------------------------------ELLAPADGTVLVRALPLALVLHEGALRLGV
1yr6A1          GQMETFLFHEFGVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALNKVDLLSEE
1ckeA           RQRAFRELPGL---IADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFRLLAKLVPAAD
1dwmA           --------------------------------------SGNMAAATVERENRNVHAIVLKEGSAMTKDFC
1mkyA1          NKAENLREFEREVKPELYSLGFGEPI----PVSAEHNINLDTXLTIIKKLEEK-----------------
1tueA           ----------------------------------------------------------------------
1t9hA2          HYVEFMTEIKDR----------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1a4iA2          -----------------------AEILNGKE---ISAQIRARLKNQVTQLKEPGFTPRLAILQVGNRDDS
1oa8A           AVIQFAVGEHRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTL--------
1g31A           ---------------LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVGEVPELCVVHSVGPDVPCEV
1pgsA2          ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1jqjA2          --LRTVATDGHRLAVCSMPLPSHSVIVVIELMRMLDGGDNPLRVQIGSNNIHVGDFIFT-----------
1p5zB           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1odfA           -DKSQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFN-----------PILQGIENNDLLTGDMV------
1oftA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1iioA           -DVELKASDAGQVLTADDPFKSAEEVADTIVNKA------------------------------------
1tpzA           ----------------------------------------------------------------------
1tzbA           ------------------------------------SYSGNETLYTVEYAKRRRIPAVAITTGGRLAQMG
4tmkA           ----------------------------------------------------------------------
1qvrA2          ----------------PALERRFQPVYVDEPTV-------EETISILRGLKEKVHHGVRISDSAIIAA--
1sfjA           ---YGQFTNDSYLNLISDLANINGIDMIDEWQADIDI---EKHQRIITHLQQYNKEVIISHHNFESTPPL
1wr8A           ----------------------------------------EKALEAIRRAESLGIPIMLVTGNTVQFAEA
1dg3A2          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1tf7A1          --GGFDLSALIERINYAIQKYRARRVSIDSVTSVFSSVVRRELFRLVARLKQIGATTVMTTER-------


                         .         .         .         +         .         .         .:280
query           ERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSFREALSMAWLAMAxxxxxxxxxxxxxx
1b0uA           SHVIFLHQGKIEEEGDPEQ---------------------------------------------------
1sgwA           DVNENLHKY-------------------------------------------------------------
1ji0A           HYGYVLETGQIVLEGKASE---------------------------------------------------
1q3hA           DKILILHQGSSYFYGTFSE---------------------------------------------------
1pf4A1          DEILVVDEGEIIERGRHAD---------------------------------------------------
1e69A           DLLHGV----------------------------------------------------------------
1l7vC           HRAWLLKGGKXLASGRREE---------------------------------------------------
1m3eA1          EEIVDI-------GSFAPEDIHIPKVHRLVKGEKYEKRIERLSVR-------------------------
2yyeA2          ----------------------------------------------------------------------
1ex6A           KDFIFAE---------------------------------------------------------------
1urjA           LTEVDDAGPAHSKPS-------------------------------------------------------
1e9rA           PDGDFSIRS-------------------------------------------------------------
1khbA1          QHGVFVGAAMRSEAKIIMH---------------------------------------------------
1mukA           -ILRFLGAGMVM----------------------------------------------------------
1pv4A3          EEFKGTGNXELHLSRKIAEKRVFPAID-------------------------------------------
1nijA1          ERLARINARAPVYTVTHGDIDLGL----------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1bmfA3          TNVISITDGQIFLEELFYKGIRPA----------------------------------------------
2v3jA1          DEKVGLSNYPLSASVACSK---------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1ffhA2          LSARHVTGKPIYFAGLEPF---------------------------------------------------
2gx8A1          KQLQEKVDAKKLVHIHASQLHTD-----------------------------------------------
1jalA1          KSYNFLTLKPTMYIANVNEDGFENNPYLDRV---------------------------------------
1kgdA           EEAVE-----------------------------------------------------------------
1jjvA           DDVINNDAELAQNLPHLQQ---------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1n25A           KEFSLSVYQKMK----------------------------------------------------------
1t06A           KEVGIVEVKRDLLNASESIQK-------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          DHVIRI----------------------------------------------------------------
1grqA           WAIAAH----------------------------------------------------------------
1bgxT2          DRIHVLHPEGYLITPAWLWEK-------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1lw7A2          SELQ------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1mjgM           VLCQSFAPNHVCIVTP------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2iqhA1          QLVWMACHSAAFEDLRVSSFIRGTKV--------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1bs2A1          QVSSCYDVLWVAGQTEELATARLALYGAA-----------------------------------------
1cd5A           ----------------------------------------------------------------------
1vplA           DRIALIHNGTIVETGTVEE---------------------------------------------------
1udwA           FEEFCLPTKKYADVIIPRGADNLVAIN-------------------------------------------
1poiA           KYTI------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ak2A1          LAAFS-----------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1o7d.2          PRDLVIQNEYL-----------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
2vgmA3          QLIACILKYPL-----------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1e3mA2          REL-------------------------------------------------------------------
2qgmA1          NEYIQTG---------------------------------------------------------------
2gk3A1          AEVLPVDGDDRVEKPEGIC---------------------------------------------------
1g6hA           DHLYVMFNGQIIAEGRGEEEIKNVLSDPKVV---------------------------------------
1j1zA2          REVLHQRDMLSPKYAELVYYGFWYAPEREALQAYFDH---------------------------------
1f8xA           DIMLGVYIPDEEDVGLGMELGYALSQ--------------------------------------------
1np6A           ----------------------------------------------------------------------
1zs3A1          AGVVELYGY-------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1cr0A           DTIIALERNQLV----------------------------------------------------------
1ii8.1          DHVIRISLENGSS---------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1tmkA           ESITIVDVTNKGIQEVEAL---------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1v37A           RALGEDGLVPP-----------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dhyA1          QRKVMGLLCLQDPFGLPLE---------------------------------------------------
1esmA           NRFLKFREGAFT----------------------------------------------------------
2pa7A1          QYDNFKKYIAKI----------------------------------------------------------
1g8yA           SYLSSMTSAEAEEWGVDDDQRRFFVRFGVSKA--------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
3cddA1          NTLVPVIDE-------------------------------------------------------------
1afrA           PDGTVLAFADMMRKKISMPAHLMYD---------------------------------------------
2je6I3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1mm8A           FRTVGLLHQEWW----------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1sbxA           ILPFSAPSCGLITKTDAER---------------------------------------------------
1v47A1          NTVALLHGGERV----------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1em8A           EALWARPAESFVPHNLAGE---------------------------------------------------
1vhhA           SEESLHYEGRAVDITTSDRDRSKYGMLAR-----------------------------------------
1w1wA           DALVGVY---------------------------------------------------------------
1dnpA2          DVEVERALRNVVCEGFDDSVILPPGAVMT-----------------------------------------
1jqjA3          ----------------------------------------------------------------------
1yvuA2          SKIVVHRDGRLYR---------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1q3tA           ARDYKDSHRETSPLKQAE--------DAVYLDT-------------------------------------
1g8fA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1iqrA2          DGRV------------------------------------------------------------------
1zbsA1          PAVYSLVQNSFDDFLVRNV---------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1uouA3          GAELLVDVGQRLRRGTPWL---------------------------------------------------
1yr6A1          EKERHRKY--------------------------------------------------------------
1ckeA           ALVLDSTTLSI-----------------------------------------------------------
1dwmA           DRVWVIVNDHGV----------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1a4iA2          NLYINVKLKAAEEIGIKATHIKLPR---------------------------------------------
1oa8A           ----------------------------------------------------------------------
1g31A           GDLTSLPVGQIRNVP-------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1tzbA           VPTVIVPKA-------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1sfjA           DELQFIF-----------FKMQKFNPEYVKLAVMPHLLQAMSTFSDTMDCKVVGIS--------------
1wr8A           ASILIGTSGPVV----------------------------------------------------------
1dg3A2          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1tzbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1dg3A2          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1tzbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1dg3A2          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1tzbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1dg3A2          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1tzbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1dg3A2          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0uA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1tzbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
1dg3A2          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1tf7A1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxx
1b0uA           ------------------
1sgwA           ------------------
1ji0A           ------------------
1q3hA           ------------------
1pf4A1          ------------------
1e69A           ------------------
1l7vC           ------------------
1m3eA1          ------------------
2yyeA2          ------------------
1ex6A           ------------------
1urjA           ------------------
1e9rA           ------------------
1khbA1          ------------------
1mukA           ------------------
1pv4A3          ------------------
1nijA1          ------------------
2gtlM1          ------------------
1bmfA3          ------------------
2v3jA1          ------------------
2gujA1          ------------------
1ffhA2          ------------------
2gx8A1          ------------------
1jalA1          ------------------
1kgdA           ------------------
1jjvA           ------------------
1qhlA           ------------------
1tljA           ------------------
1n25A           ------------------
1t06A           ------------------
1ni3A1          ------------------
1f2t.1          ------------------
1grqA           ------------------
1bgxT2          ------------------
1c4oA1          ------------------
1ohcA1          ------------------
1f46A           ------------------
1lw7A2          ------------------
1zp6A1          ------------------
1mjgM           ------------------
1jbkA           ------------------
1xbtA1          ------------------
1d6jA           ------------------
2iqhA1          ------------------
1rkbA           ------------------
1e6cA           ------------------
1bs2A1          ------------------
1cd5A           ------------------
1vplA           ------------------
1udwA           ------------------
1poiA           ------------------
2axpA1          ------------------
1s9hA           ------------------
1i1qA           ------------------
1ak2A1          ------------------
1qhdA1          ------------------
1t3wA           ------------------
1o7d.2          ------------------
2f9hA1          ------------------
2vgmA3          ------------------
1fl9A           ------------------
3cddA2          ------------------
1e3mA2          ------------------
2qgmA1          ------------------
2gk3A1          ------------------
1g6hA           ------------------
1j1zA2          ------------------
1f8xA           ------------------
1np6A           ------------------
1zs3A1          ------------------
1atrA1          ------------------
1jb1A           ------------------
1cr0A           ------------------
1ii8.1          ------------------
1g6oA           ------------------
2fggA1          ------------------
1ckvA           ------------------
1es6A2          ------------------
1viaA           ------------------
1tmkA           ------------------
1l3aA           ------------------
1l7lA           ------------------
1v37A           ------------------
1mi8A           ------------------
1dhyA1          ------------------
1esmA           ------------------
2pa7A1          ------------------
1g8yA           ------------------
1ovmA2          ------------------
2vnuD1          ------------------
3cddA1          ------------------
1afrA           ------------------
2je6I3          ------------------
2ancF1          ------------------
1yj5A2          ------------------
1mm8A           ------------------
1bccF           ------------------
1sbxA           ------------------
1v47A1          ------------------
1gm5A1          ------------------
1b77A2          ------------------
1em8A           ------------------
1vhhA           ------------------
1w1wA           ------------------
1dnpA2          ------------------
1jqjA3          ------------------
1yvuA2          ------------------
1l1oA           ------------------
1q3tA           ------------------
1g8fA3          ------------------
1d8jA           ------------------
1iqrA2          ------------------
1zbsA1          ------------------
1xl3C1          ------------------
1uouA3          ------------------
1yr6A1          ------------------
1ckeA           ------------------
1dwmA           ------------------
1mkyA1          ------------------
1tueA           ------------------
1t9hA2          ------------------
1e2hA           ------------------
1a4iA2          ------------------
1oa8A           ------------------
1g31A           ------------------
1pgsA2          ------------------
1j90A           ------------------
1jqjA2          ------------------
1p5zB           ------------------
1puoA2          ------------------
1odfA           ------------------
1oftA           ------------------
1rz3A           ------------------
1iioA           ------------------
1tpzA           ------------------
1tzbA           ------------------
4tmkA           ------------------
1qvrA2          ------------------
1sfjA           ------------------
1wr8A           ------------------
1dg3A2          ------------------
1lnzA2          ------------------
1tf7A1          ------------------