[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF69636.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a80A.bssp"
#ERROR : Can't open dsspfile "1pyfA.bssp"
#ERROR : Can't open dsspfile "1og6A.bssp"
#ERROR : Can't open dsspfile "1pz1A.bssp"
#ERROR : Can't open dsspfile "1lqaA.bssp"
#ERROR : Can't open dsspfile "1gveA.bssp"
#ERROR : Can't open dsspfile "1exbA.bssp"
#ERROR : Can't open dsspfile "2jokA1.bssp"
#ERROR : Can't open dsspfile "1m65A.bssp"
#ERROR : Can't open dsspfile "1d0nA6.bssp"
#ERROR : Can't open dsspfile "1chuA3.bssp"
#ERROR : Can't open dsspfile "1nz0A.bssp"
#ERROR : Can't open dsspfile "1b9kA2.bssp"
#ERROR : Can't open dsspfile "1k2yX1.bssp"
#ERROR : Can't open dsspfile "1ybfA.bssp"

## Summary of PDB Search
:289
    7e-60  42%  1a80A  [c.1.7.1] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    8e-54  28%  1pyfA  [c.1.7.1] IOLS PROTEIN
    3e-53  25%  1og6A  [c.1.7.1] HYPOTHETICAL OXIDOREDUCTASE YDHF
    8e-49  25%  1pz1A  [c.1.7.1] GENERAL STRESS PROTEIN 69
    3e-42  23%  1lqaA  [c.1.7.1] TAS PROTEIN
    6e-42  23%  1gveA  [c.1.7.1] AFLATOXIN B1 ALDEHYDE REDUCTASE
    2e-38  23%  1exbA  [c.1.7.1] KV BETA2 PROTEIN
    1e-30  12%  2jokA1 [a.168.1.1] PUTATIVE G-NUCLEOTIDE EXCHANGE FACTOR A:78 --
    1e-26   9%  1m65A  [c.6.3.1] HYPOTHETICAL PROTEIN YCDX
    7e-20  12%  1d0nA6 [d.109.1.1] HORSE PLASMA GELSOLIN A:629 -- 755
    3e-19  19%  1chuA3 [d.168.1.1] PROTEIN (L-ASPARTATE OXIDASE) A:238 -- 353
    8e-15  16%  1nz0A  [d.14.1.2] RIBONUCLEASE P PROTEIN COMPONENT
    1e-08   8%  1b9kA2 [d.105.1.1] PROTEIN (ALPHA-ADAPTIN APPENDAGE DOMAIN) A:825
    8e-06  14%  1k2yX1 [c.84.1.1] PHOSPHOMANNOMUTASE X:5 -- 154
    4e-04  21%  1ybfA  [c.56.2.1] AMP NUCLEOSIDASE
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTR
1a80A           VPSIVLNDGNSIPQLGYGVFKV-PPADTQRAVEEALEVGYRHIDTAAIYGNEEGVG----AAIAASGIAR
1pyfA           -----------NAVGGHNLYPNLNEETGKELVREAIRNGVTXLDTAYIYGIEELIGEVLREF------NR
1og6A           VQRTIAPQGPEFSRFVMGYWRLMSARQLVSFIEEHLDLGVTTVDHADIYGGYQC-EAAFGEALKLAPHLR
1pz1A           -EYTSIADTIEASRIGLGTWAITDEKTSIETIRAALDQGITLIDTAPAYGSEEIVGKAIKEYXK-----R
1lqaA           MQYHRIPHSLEVSTLGLGTMTFNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWLA
1gveA           -----------RPATVLGAMEMMDVTSSSRSVRAFLQRGHTEIDTAFVYANGQSET--ILGDLGLGLGRG
1exbA           ------KSGLRVSCLGLGTWVTITDEMAEHLMTLAYDNGINLFDTAEVYAAGKA-EVVLGNIIKKKGWRR
2jokA1          ---------------------------------------------------------------------R
1m65A           -----------------------AYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHFIN----MRI
1d0nA6          ----------------------------------MDAHPPRLFACSNKIGRFVI-EEVPGEFMQEDLATD
1chuA3          --------------------------------------EFNQFHPTALYHRNFLLTEALRGEGAYLKRPD
1nz0A           ----------------------------------------------------------------------
1b9kA2          ------------------------------------------------EMAQDFFQRWKQLSNP-----Q
1k2yX1          ---------------------------------------------------------WIGRAIGSESLAR
1ybfA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWRALEDAYEAGKLKAIGVS
1a80A           DDLFITTKLWNDRH-DGDEPAAAIAESLAKLALDQVDLYLVHWPTPNYVHAWEKMIELRAAGLTRSIGVS
1pyfA           EDVVIATKAAHRKQGNPDFLKKSVDESLKRLNTDYIDLFYIHDEHTPKDEAVNALNEXKKAGKIRSIGVS
1og6A           ERMEIVSKCGIATTARRDHIIKSAEQSLINLATDHLDLLLIHRPLMDADEVADAFKHLHQSGKVRHFGVS
1pz1A           DQVILATKTALDRHANRARIVEEVENSLKRLQTDYIDLYQVHWPLVPIEETAEVXKELYDAGKIRAIGVS
1lqaA           KKLIIASKVSGPSRNNDKNIREALHDSLKRLQTDYLDLYQVHWPQRSLLDTLDALAEYQRAGKIRYIGVS
1gveA           CKVKIATKAAPMKTLKPADVRFQLETSLKRLQCPRVDLFYLHDHGTPIEETLQACHQLHQEGKFVELGLS
1exbA           SSLVITTKIFWGGKASRKHIIEGLKASLERLQLEYVDVVFANRPDPPMEETVRAMTHVINQGMAMYWGTS
2jokA1          HFVDEAVKQVAHARTPAEFGRQVYEATLCAIFSEAKDRFCMDPATRGDAARATGLPGADKQGVFTPSGAG
1m65A           WPRVVDGVGILRGIEANIKNVD-GEIDCSGKMFDSLDLIIAGFHEPVFAPHTQAMIATIASGNVHIISHP
1d0nA6          DVMLLDTWDQVFVW-VGKDSQDEEKTEALTSAKRYIDTDPAHRDRRTPIVVKQGFEPPSFVGWFLGWDDS
1chuA3          GTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYE-----KLLGLGID
1nz0A           ----------------------------------------------------------------------
1b9kA2          QEVQNIFKAKHPTKAKIIGFGSALLEEVDPNPANFVGAGIIH----------------------------
1k2yX1          GEPCVAVGRDGRLS-GPELVKQ-LIQGLVDCGCQVSDVGMVPTPVLYYLEGKSGVMLTGAHNPPDYNGFK
1ybfA           ---------EVPSLPSFSVLRA-ISSAIQNKGKDYWTVWEYDEKFKDYLRSTHASGVDXETATLXTVG--


                         +         .         .         .         .         *         .:210
query           NFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADA
1a80A           NHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAA
1pyfA           NFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGAGKYTEDTTLAPIAEK
1og6A           NFTPAQFALLQSRLPFTLATNQVEISPVH-QPGTLDQLQQLRVRPMAWSCLGGGRLQPLRDELAVVAEEL
1pz1A           NFSIEQXDTFRAVAPLHTIQPPYNLFEREXEESVLPYAKDNKITTLLYGSLCRGNHDPKEYLSLDKLAKT
1lqaA           NETAFGVMRYLHLADKVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGRFTRYSGEQYVDIARR
1gveA           NYVSWEVAEICTLCKIMPTVYQGMYNAITRQVETFPCLRHFGLRFYAFNPLAGGLLTGRVEKALKTTYGP
1exbA           RWSSMEIMEAYSVARIPPICEQAEYHMFQREKVEPELFHKIGVGAMTWSPLACGRRQQAKLKELQAIAER
2jokA1          TNPLYTEIRLRADTLLAARPEYRELQPYARQQAIANALPAERSNTLVEFRQTVQTLTYRRAAQDASRDEK
1m65A           GNPKYEIDVKAVAEAAAKHQVALEINNSSNCREVAAAVRDAGGWVALGSDSHTAFTMGEFEE-CLKILDA
1d0nA6          YWSVDPLDRALAELA-------------------------------------------------------
1chuA3          LTQ--------EPVPIVPAAH-------------------------------------------------
1nz0A           -----------------------------------------YFVVLFRKNGXDYSR--LGIVVKRKFGKA
1b9kA2          ----------------------------------------------------------------------
1k2yX1          IVVAG-----------------------------------------------------------------
1ybfA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGYVGEAVKHFNPEFVR
1a80A           HGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGD--------------
1pyfA           HNVDIPHIVLAWYLARPDILIPGAKRADQLIDNIKTADVTLSQEDISFIDKL------------------
1og6A           NAGSIEQVVNAWVLRLQPLPIIGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGY--------------
1pz1A           YGKSVIHLAVRWILDQPDIALWGARKPGQLEALSEITGWTLNSEDQKDINTILENTISDPV---GPEF--
1lqaA           HGLDPAQMALAFVRRQPFSTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVY--------------
1gveA           TAPSMISAAVRWMYHHGDAVILGMSSLEQLEQNLALVEGPLEPAVVDAFDQAW-----NLVAHECPNYFR
1exbA           LGCTLPQLAIAWCLRNESSVLLGASNAEQLMENIGAIQVKLSSSIVHEIDSI------------------
2jokA1          GATNAADG--------------------------------------------------------------
1m65A           VDFPPERILLNFLESRGMAPIAEFAD--------------------------------------------
1d0nA6          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1nz0A           TRRNKLKRWVREIFRRNKGVIPKGFPRKKLSEEFERVDFWTVREKLLNL---------------------
1b9kA2          ----------------------------------------------------------------------
1k2yX1          ----------------------------------------------------------------------
1ybfA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
1a80A           ---------
1pyfA           ---------
1og6A           ---------
1pz1A           ---------
1lqaA           ---------
1gveA           ---------
1exbA           ---------
2jokA1          ---------
1m65A           ---------
1d0nA6          ---------
1chuA3          ---------
1nz0A           ---------
1b9kA2          ---------
1k2yX1          ---------
1ybfA           ---------