[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF69712.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dabA.bssp"
#ERROR : Can't open dsspfile "1wcdJ1.bssp"
#ERROR : Can't open dsspfile "1ogpA1.bssp"
#ERROR : Can't open dsspfile "1bglA2.bssp"
#ERROR : Can't open dsspfile "2je8A4.bssp"
#ERROR : Can't open dsspfile "1dabA.bssp"
#ERROR : Can't open dsspfile "1wcdJ1.bssp"
#ERROR : Can't open dsspfile "1ogpA1.bssp"
#ERROR : Can't open dsspfile "1ogpA1.bssp"

## Summary of PDB Search
:3824
    6e-07   8%  1dabA  [b.80.1.7] P.69 PERTACTIN
    8e-07  12%  1wcdJ1 [b.121.4.9] MAJOR STRUCTURAL PROTEIN VP2 J:11 -- 431
    2e-05  21%  1ogpA1 [b.1.18.6] SULFITE OXIDASE A:263 -- 389
    9e-05  16%  1bglA2 [b.1.4.1] BETA-GALACTOSIDASE A:626 -- 730
    3e-04  21%  2je8A4 [b.18.1.5] BETA-MANNOSIDASE A:28 -- 219
    2e-05   7%  1dabA  [b.80.1.7] P.69 PERTACTIN(query 2568->2827)
    2e-04  15%  1wcdJ1 [b.121.4.9] MAJOR STRUCTURAL PROTEIN VP2 J:11 -- 431(query 2062->2294)
    2e-04  18%  1ogpA1 [b.1.18.6] SULFITE OXIDASE A:263 -- 389(query 2381->2459)
    2e-04  22%  1ogpA1 [b.1.18.6] SULFITE OXIDASE A:263 -- 389(query 2485->2561)
:3824

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGSAGTVIHIYANGQEIGSTTVDSSGSWRFAITSALADGE
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          -------------------------------EGLDTYADVYLNGSLLLKAD-NMFVGYTLPVKSVLRKGE
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NHFTAIATNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          NHLYIYFHS-------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNGQTTNDNRPTLSGTAEAGARVEVFDNGVSLG
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          --------------------------------------DVQMVKPGKVSIKGYAVSGERVDISDGGKNWV
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           LATLQPNGGWTFTPSQNLGEGAHRLTVIATDAKGNASPAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          EASRTQEPGWVLFEATIDVSQTTEVIAKAVDSAANVQPE-------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1960
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2030
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2100
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxITGNLVSGQLTNDATPTLNGRGEAGATINVYLDGNPASI
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          -------------------------------INAVTFQGSLSELTDVSYNGLMSATANINDKI-GNVLVG
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2170
query           GTTTVNSDGTWSFTPQTPLANGSHTFTLSATDPAGNSSAVSSGFVLTIDATPPAAPVIASVADNTAPVTG
1dabA           ---------------------------------------------------------------------G
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          EGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYAADDYQFSSQYQPGGVTITLFSANI
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2240
query           IVPNGGSTNETRPTLSGTGEAGTTISIYNGSALVGTAQVQANGSWSFTPSTSLGAGVWNLTATATDAAGN
1dabA           AVPGGFGPGGFGPVLDGWYGVDVSGSSVELAQSIVEAPELGAAIRVGRGARVTVPGGSLSAPHGNVIETG
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          DAITSLSVGGELVFRTSVHGLVLGATIYLIGFDGTTVITRAVAANNGLTTGTDNLMPFNLVIPTNEITQP
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:2310
query           TSAASEIRSFTIDTTAPAAPVIDTVYDGTGPITGNLSSGQITDEARPVISGTRETNTTIRLYDNGTLLAE
1dabA           GARRFAPQAAPLSITLQAGAHAQGKALLYRVLPEPVKLTLTGGADAQGDIVATELPSIPGTSIGPLDVAL
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ITSIKLEIVTSKSGGQAGDQM---SWSARGSLAVTIHGGNYPGALRPVTLVAYE----------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:2380
query           IPADNSSSWRYTPDASLATGNHVITVIAVDAAGNASPVSDSVNFVVDTTPPLTPVITSVSDDQAPGLGTI
1dabA           ASQARWTGATRAVDSLSIDNATWVMTDNSNVGALRLASDGSVDFQQPAEAGRFKVLTVNTLAGSGLFRMN
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:2450
query           ANGQNTNDPTPTFSGTAEAGATITLYENGTVIGTTTAQPDGAWSVSTSTLASGTHVITAVATDAAGNSSP
1dabA           VFADLGLSDKLVVMQDASGQHRLWVRNSGSEPASANTLLLVQTPLGSAATFTLANKDGKVDIGTYRYRLA
1wcdJ1          --------------------SELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDP
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          EDVQMVKPGKVSIKGYAVSGRGIERVDDGGKNWVESSDKWAWVLFEATIDVSQTTEVIAKAVDSAANVQP
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:2520
query           NSTAFTLTVDTTAPQTPILTSVVDDVAGGVTGNLANGQITNDNRPTLNGTAEAGSVVSIYDGDTLLGVTS
1dabA           ANGNGQWSLVGAK---------------------------------------------------------
1wcdJ1          IPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQPGGVTITLFSANIDATSLSVGGELVFRTSVHG
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ENVESVWNL-------------------------------------------------------------
1ogpA1          ----------------------------------EDVQMVKPGKVSIKGYAVSGGDISLDGGKNWVEASR


                         .         .         +         .         .         .         .:2590
query           ANASGAWSFTPTTGLNDGTRTLTVTATDPAGNVSPATSGFTIVVDTLAPTVPLITSIVDDVPNNTGAIGN
1dabA           ----------------------------------------------------------------------
1wcdJ1          LVLGATIYLIGFDGTTVITRAVAANNGLTTG--TDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAG
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           -----------------------------------------------SVELAQSIVEAPELGAAIRVGRG
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          TQEPGAWVLFEATIDVSQTTEVIAKAVDSAANVQPENVESV-----------------------------


                         *         .         .         .         .         +         .:2660
query           GQSTNDTQPTLNGTAEANSAVSIFDNGALVATVNANASGNWSWTPTAALGQGSHAYXXXXXXXXXXXXXX
1dabA           ----------------------------------------------------------------------
1wcdJ1          DQMSWSARGSLAVTIHGGNY--------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ARVTVPGGSLSAPHGNVIETGGARRFAPQAAPLSITLQAGAHAQGKALLYRVLPEPVKLTLTGGADAQGD
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2730
query           XPSITIIVDTIAPGAPGNLVINATGNRVTGTAEAGSTVTITSETGVVLGTATADGTGSFTATLTPAQTNG
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           IVATELPSIPGTSIGPLDVALASQARWTGATRAVDSLSIDNATWVMTDNSNVGALRLASDGSVDFQQPAE
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2800
query           QPLLAFAQDKAGNTGIAAGFTAPDTRVPEAPIITNVVDDVGIYTGAIANGQVTNDAQPTLNGTAQAGATV
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           AGRFKVLTVNTLAGSGLFRMNVSDKLVVMQDASGQHRLWVRNSGSEPASANTLLLVQTPLGSAATFTLAN
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2870
query           SIYNNGALLGTTTANASGNWSFTPTGNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           KDGKVDIGTYRYRLAANGNGQWSLVGA-------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2940
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3010
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3080
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3150
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:3220
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:3290
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:3360
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:3430
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:3500
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTV
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          --------------------------------------------------------------------RL
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:3570
query           LKGASLVFDVSTLITLGNLNISWAIQENGTVIRNGTVPVANITLGSATVTVNLSGLELDAGTYTLNFTxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          SGQTIEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVR--
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:3640
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3710
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3780
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1bglA2          ----------------------------------------------------------------------
2je8A4          ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
1wcdJ1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------
1ogpA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3850
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dabA           --------------------------------------------
1wcdJ1          --------------------------------------------
1ogpA1          --------------------------------------------
1bglA2          --------------------------------------------
2je8A4          --------------------------------------------
1dabA           --------------------------------------------
1wcdJ1          --------------------------------------------
1ogpA1          --------------------------------------------
1ogpA1          --------------------------------------------