[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF69765.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1g4dA.bssp"
#ERROR : Can't open dsspfile "1q05A.bssp"

## Summary of PDB Search
:115
    1e-05  31%  1g4dA  [a.6.1.7] REPRESSOR PROTEIN C
    8e-04  17%  1q05A  [a.6.1.3] TRANSCRIPTIONAL REGULATOR CUER[MASQUE : MEMB(X) 0
:115

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVNEQVRxxxxxxxxxxxxxxxxxxxxx
1g4dA           CSPQEIMAADGMSVAGVHYRANVQGWTKRKKEGVKGGKAVEYDVM-------------------------
1q05A           MNISDVAKITGLTSKAIRFYEEKGLV---TPPMRSENGYRTYTQQHLNE---------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1g4dA           ---------------------------------------------
1q05A           ---------------------------------------------