[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF70211.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1x8mA.bssp"
#ERROR : Can't open dsspfile "1iu4A.bssp"
#ERROR : Can't open dsspfile "2id0A2.bssp"
#ERROR : Can't open dsspfile "1t5eA.bssp"
#ERROR : Can't open dsspfile "1bdoA.bssp"
#ERROR : Can't open dsspfile "1dxmA.bssp"
#ERROR : Can't open dsspfile "1wp1A.bssp"
#ERROR : Can't open dsspfile "1k8mA.bssp"
#ERROR : Can't open dsspfile "1ek9A.bssp"

## Summary of PDB Search
:396
    3e-21  18%  1x8mA  [b.82.1.13] 4-DEOXY-L-THREO-5-HEXOSULOSE-URONATE KETOL-
    3e-13   9%  1iu4A  [d.3.1.8] MICROBIAL TRANSGLUTAMINASE
    5e-13  12%  2id0A2 [b.40.4.5] EXORIBONUCLEASE 2 A:83 -- 172
    5e-07  16%  1t5eA  [f.46.1.1] MULTIDRUG RESISTANCE PROTEIN MEXA
    9e-06  14%  1bdoA  [b.84.1.1] ACETYL-COA CARBOXYLASE
    3e-05  15%  1dxmA  [b.84.1.1] H PROTEIN
    2e-04  15%  1wp1A  [f.5.1.1] OUTER MEMBRANE PROTEIN OPRM
    4e-04  12%  1k8mA  [b.84.1.1] E2 COMPONENT OF BRANCHED-CHAIN AHPHA-KETOACID
    7e-04  14%  1ek9A  [f.5.1.1] OUTER MEMBRANE PROTEIN TOLC
:396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFGRLDEVSTGNGKVIPSSREQVLQSLD
1x8mA           ----------------------------------------------------------------------
1iu4A           ----------------------------------------------------------------------
2id0A2          ----------------------------------------------------------------------
1t5eA           ----------------------------------------------------------------------
1bdoA           --------------------------------------------GQKVNVGDTLCIVEAMKMMNQIEADK
1dxmA           -------------------------------------------YAPSHEWVKHEGSVATIGITDHAQDHL
1wp1A           ----------------------------------------------------------------------
1k8mA           --------------------------------------------------------VQSDKASVTITSRY
1ek9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GGILAQLTVREGDRVQANQIVARLDPTRLASNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1x8mA           ----------------------------------------------------------------------
1iu4A           ----------------------------------------------------------------------
2id0A2          ----------------------------------------------------------------------
1t5eA           ----------------------------------------------------------------------
1bdoA           SGTVKAILVESGQPVEFDEPLVVIE---------------------------------------------
1dxmA           GEVVFVELPEPGVSVTKGKGFGAVESVKATSDV-------------------------------------
1wp1A           ----------------------------------------------------------------------
1k8mA           DGVIKKLYYNLDDIAYVGKPLVDIETE-------------------------------------------
1ek9A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xIAAETRLYKSRRAQLADTEAELRDALASVNKELAITQRLEKSGAASHVEVLRLQRQKSDLGLKITDLRS
1x8mA           ----------------------------------------------------------------------
1iu4A           ----------------------------------------------------------------------
2id0A2          ----------------------------------------------------------------------
1t5eA           ----------------------------------------------------------------------
1bdoA           ----------------------------------------------------------------------
1dxmA           ----------------------------------------------------------------------
1wp1A           -AFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRL
1k8mA           ----------------------------------------------------------------------
1ek9A           -LILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNARAQYDTVLANELTARN


                         .         .         .         +         .         .         .:280
query           QYYVQAREALSKANAEVDMLSAILKGREDSVTRLTVRSPVRGIVKNIQVTTIGGVIPPNGEMMEIVPVDD
1x8mA           ---------------------------------LVEKVFVADEYTMVYSIIVGGIMPITKTVSVGGEVGK
1iu4A           PSYGRAETVVNNYIRKWQQVYSHRDGRKQQMTEEQREWLSYGCVGVTWV-NSGQYPTNRLAFASFDEDRF
2id0A2          -------------------------------------------------TRFVGKVQGKNDRLAIVPDHP
1t5eA           ADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLD
1bdoA           ----------------------------------------------------------------------
1dxmA           ----------------------------------------------------------------------
1wp1A           NQL-TSEVNLYKA---------------------------------------------------------
1k8mA           ----------------------------------------------------------------------
1ek9A           N-LDNAVEQLR-----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RLLIETRLSPRDIAFIHPGQRALVKITAYDYAIYGGLDGVVETISPDTIQDKVKPEIFYYRVFIRTHQDY
1x8mA           QLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHR-DALYVGKGAKEVVDTGTPAKFYY-NCAPAHTTY
1iu4A           GRPRSGETRAEFEGRVAKESFDEEKGFQRAREVASVMNRALENAHDESAY------LDNLKKELANGNDA
2id0A2          LLKDAIPCRAARGLEFKEGDWAVAEXRRHPLKGDRSFYAELTQYITF-----------------------
1t5eA           PIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPEFSEVSVDEGTGSVTIRAV-----
1bdoA           ----------------------------------------------------------------------
1dxmA           ----------------------------------------------------------------------
1wp1A           ----------------------------------------------------------------------
1k8mA           ----------------------------------------------------------------------
1ek9A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LQNKSGRRFSIVPGMIATVDIKTGEKTIVDYLIKPFNRAKEALxxx
1x8mA           PTKK--VTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLS---
1iu4A           L----------RNEDARSPFYSALRNT-------------------
2id0A2          ----------------------------------------------
1t5eA           FPNPNNE---LLPGMFVHAQL-------------------------
1bdoA           ----------------------------------------------
1dxmA           ----------------------------------------------
1wp1A           ----------------------------------------------
1k8mA           ----------------------------------------------
1ek9A           ----------------------------------------------