[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF70265.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"
#ERROR : Can't open dsspfile "2r6gG1.bssp"

## Summary of PDB Search
:324
    2e-06  14%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    4e-05  13%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
    2e-04  12%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
:324

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxW
3dhwA1          ----------------------------------------------------------------------
2onkC1          ----------------------------------------------------------------------
2r6gG1          ---------------------------------------------------------------------H


                         .         .         *         .         .         .         .:140
query           FWRLLQGDMGYSMLFNMPVASVIRERFATSFALLAGAWLLSGVLGVTLGFLAGRFLHRWPDKMICRISYL
3dhwA1          --------------------WLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVT--RPGQIIANAKLYR
2onkC1          -------------------------AVWKVVLTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGI
2r6gG1          WKLALGFSVITPPPFPVLLW------LWNSVKVAGISAIGIVALSTTCAYAFARM-RFPGKATLLKGMLI


                         +         .         .         .         .         *         .:210
query           LSSLPTFWIAMLLLALFAVRWPVLPVCCAWDPGNNAGTALLSERLRHLVLPVCALSLLGMGQIALHTREK
3dhwA1          TVSAIVNIFRSIPFIILLVWMIPFT-------------RVIVGTSIGLQAAIVPLTVGAAPFIARMVENA
2onkC1          VDLPVVIPHTVAGIALLVVFGSSGLIG----------SFSPLKFVDALPGIVVAMLFVSVPIYINQAKEG
2r6gG1          FQMFPAVLSLVALYALFDRLGEYIPFIG-----------------LNTHGGVIFAYLGGIALHVWTIKGY


                         .         .         .         +         .         .         .:280
query           IASVMKSEFIRFARAQGDKGWSLLCHQVLRHAITPALCLQFASXXXXXXXXXXXXKVFAYPGLGQATIDA
3dhwA1          LLEIPT-GLIEASRAMGATPMQIVRKVLLPEALVNAATITLIT---------------------------
2onkC1          F-ASVDVRLEHVARTLGSSPLRVFFTVSLVRHIVAGAIMSWARGISEFGAVVVI--AYYPMIAPTLIYER
2r6gG1          FETIDS-SLEEAAALDGATPWQAFRLVLLPLSVPILA---------------------------------


                         .         *         .         .         .         .         +:350
query           GLRGDVPLLMGIVLFCTLLVFAxxxxxxxxxxxxxxxxxxxxxx
3dhwA1          --------------------------------------------
2onkC1          YLSEGLSAAMPVAAILILLSLA----------------------
2r6gG1          --------------------------------------------