[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF70405.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cu2A2.bssp"
#ERROR : Can't open dsspfile "1pmiA.bssp"
#ERROR : Can't open dsspfile "3bu7A1.bssp"
#ERROR : Can't open dsspfile "1hrkA.bssp"
#ERROR : Can't open dsspfile "1qwrA.bssp"
#ERROR : Can't open dsspfile "1fi2A.bssp"
#ERROR : Can't open dsspfile "2atfA1.bssp"
#ERROR : Can't open dsspfile "1sq4A.bssp"
#ERROR : Can't open dsspfile "1jv1A.bssp"
#ERROR : Can't open dsspfile "1cauA.bssp"
#ERROR : Can't open dsspfile "1qwjA.bssp"
#ERROR : Can't open dsspfile "2gm6A1.bssp"
#ERROR : Can't open dsspfile "1b0pA3.bssp"
#ERROR : Can't open dsspfile "1ey2A.bssp"
#ERROR : Can't open dsspfile "1tzfA.bssp"
#ERROR : Can't open dsspfile "1j1lA.bssp"
#ERROR : Can't open dsspfile "1j58A.bssp"
#ERROR : Can't open dsspfile "1dzrA.bssp"
#ERROR : Can't open dsspfile "1o4tA.bssp"
#ERROR : Can't open dsspfile "1j3pA.bssp"
#ERROR : Can't open dsspfile "1fxzA1.bssp"
#ERROR : Can't open dsspfile "1cauB.bssp"
#ERROR : Can't open dsspfile "1sfnA.bssp"
#ERROR : Can't open dsspfile "1vj2A.bssp"
#ERROR : Can't open dsspfile "1fxzA2.bssp"
#ERROR : Can't open dsspfile "1y9qA2.bssp"
#ERROR : Can't open dsspfile "1yfuA1.bssp"
#ERROR : Can't open dsspfile "1zrrA1.bssp"
#ERROR : Can't open dsspfile "2pytA1.bssp"
#ERROR : Can't open dsspfile "1gqgA.bssp"
#ERROR : Can't open dsspfile "1w77A1.bssp"
#ERROR : Can't open dsspfile "2f4pA1.bssp"
#ERROR : Can't open dsspfile "1lr5A.bssp"
#ERROR : Can't open dsspfile "1e5kA.bssp"
#ERROR : Can't open dsspfile "1fwyA2.bssp"
#ERROR : Can't open dsspfile "1v70A.bssp"
#ERROR : Can't open dsspfile "1zz6A2.bssp"
#ERROR : Can't open dsspfile "1rc6A.bssp"
#ERROR : Can't open dsspfile "2cu2A1.bssp"
#ERROR : Can't open dsspfile "1y3tA1.bssp"
#ERROR : Can't open dsspfile "2b8mA1.bssp"
#ERROR : Can't open dsspfile "1w55A1.bssp"
#ERROR : Can't open dsspfile "1fxoA.bssp"
#ERROR : Can't open dsspfile "1yhfA1.bssp"
#ERROR : Can't open dsspfile "1jykA.bssp"
#ERROR : Can't open dsspfile "1vpaA.bssp"
#ERROR : Can't open dsspfile "1o5uA.bssp"
#ERROR : Can't open dsspfile "1wz8A1.bssp"
#ERROR : Can't open dsspfile "1x8mA.bssp"
#ERROR : Can't open dsspfile "1h3mA.bssp"
#ERROR : Can't open dsspfile "1xjaA.bssp"

## Summary of PDB Search
:478
    1e-51  34%  2cu2A2 [c.68.1.20] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL A:1 -- 268
    5e-51   9%  1pmiA  [b.82.1.3] PHOSPHOMANNOSE ISOMERASE
    3e-43  11%  3bu7A1 [b.82.1.23] GENTISATE 1,2-DIOXYGENASE A:19 -- 373
    1e-38  11%  1hrkA  [c.92.1.1] FERROCHELATASE
    5e-37  12%  1qwrA  [b.82.1.3] MANNOSE-6-PHOSPHATE ISOMERASE
    7e-29  16%  1fi2A  [b.82.1.2] OXALATE OXIDASE
    1e-28  17%  2atfA1 [b.82.1.19] CYSTEINE DIOXYGENASE TYPE I A:5 -- 190
    2e-26  18%  1sq4A  [b.82.1.11] GLYOXYLATE-INDUCED PROTEIN
    9e-25  12%  1jv1A  [c.68.1.5] GLCNAC1P URIDYLTRANSFERASE ISOFORM 1: AGX1
    5e-23  18%  1cauA  [b.82.1.2] CANAVALIN
    1e-22   8%  1qwjA  [c.68.1.13] CYTIDINE MONOPHOSPHO-N-ACETYLNEURAMINIC ACID
    3e-22  18%  2gm6A1 [b.82.1.19] CYSTEINE DIOXYGENASE TYPE I A:11 -- 202
    1e-21  12%  1b0pA3 [c.48.1.3] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    2e-21  10%  1ey2A  [b.82.1.4] HOMOGENTISATE 1,2-DIOXYGENASE
    4e-21  12%  1tzfA  [c.68.1.13] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE
    9e-21  12%  1j1lA  [b.82.1.12] PIRIN
    1e-20  13%  1j58A  [b.82.1.2] YVRK PROTEIN
    2e-19  15%  1dzrA  [b.82.1.1] DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
    3e-19  17%  1o4tA  [b.82.1.9] PUTATIVE OXALATE DECARBOXYLASE
    2e-18  12%  1j3pA  [b.82.1.7] PHOSPHOGLUCOSE ISOMERASE
    2e-18  12%  1fxzA1 [b.82.1.2] GLYCININ G1 A:10 -- 248
    4e-18  16%  1cauB  [b.82.1.2] CANAVALIN
    5e-18  16%  1sfnA  [b.82.1.11] CONSERVED HYPOTHETICAL PROTEIN
    6e-18  11%  1vj2A  [b.82.1.10] NOVEL MANGANESE-CONTAINING CUPIN TM1459
    1e-17   5%  1fxzA2 [b.82.1.2] GLYCININ G1 A:297 -- 470
    2e-17  14%  1y9qA2 [b.82.1.15] TRANSCRIPTIONAL REGULATOR, HTH_3 FAMILY A:83 --
    6e-17  14%  1yfuA1 [b.82.1.20] 3-HYDROXYANTHRANILATE-3,4-DIOXYGENASE A:1 -- 174
    1e-16  14%  1zrrA1 [b.82.1.6] E-2/E-2' PROTEIN A:1 -- 179
    1e-16  11%  2pytA1 [b.82.1.24] ETHANOLAMINE UTILIZATION PROTEIN EUTQ A:100 --
    4e-16  10%  1gqgA  [b.82.1.5] QUERCETIN 2,3-DIOXYGENASE
    5e-16  10%  1w77A1 [c.68.1.13] 2C-METHYL-D-ERYTHRITOL 4-PHOSPHATE A:75 -- 300
    5e-16  15%  2f4pA1 [b.82.1.9] HYPOTHETICAL PROTEIN TM1010 A:2 -- 135
    7e-16  15%  1lr5A  [b.82.1.2] AUXIN BINDING PROTEIN 1
    8e-15  14%  1e5kA  [c.68.1.8] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    5e-14  21%  1fwyA2 [c.68.1.5] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE A:3 --
    7e-14  23%  1v70A  [b.82.1.9] PROBABLE ANTIBIOTICS SYNTHESIS PROTEIN
    3e-13   9%  1zz6A2 [b.82.1.10] HYDROXYPROPYLPHOSPHONIC ACID EPOXIDASE A:77 --
    7e-13  16%  1rc6A  [b.82.1.11] HYPOTHETICAL PROTEIN YLBA
    2e-11  19%  2cu2A1 [b.81.4.1] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL A:269 --
    2e-09  22%  1y3tA1 [b.82.1.5] HYPOTHETICAL PROTEIN YXAG A:5 -- 334
    4e-09  18%  2b8mA1 [b.82.1.18] HYPOTHETICAL PROTEIN MJ0764 A:1 -- 108
    8e-08  11%  1w55A1 [c.68.1.13] ISPD/ISPF BIFUNCTIONAL ENZYME A:3 -- 207
    3e-07  19%  1fxoA  [c.68.1.6] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    6e-07  22%  1yhfA1 [b.82.1.9] HYPOTHETICAL PROTEIN SPY1581 A:1 -- 112
    2e-05  24%  1jykA  [c.68.1.13] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    8e-05  16%  1vpaA  [c.68.1.13] 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE
    4e-04  15%  1o5uA  [b.82.1.8] NOVEL THERMOTOGA MARITIMA ENZYME TM1112
    5e-04  17%  1wz8A1 [c.14.1.3] ENOYL-COA HYDRATASE A:2 -- 264
    6e-04  23%  1x8mA  [b.82.1.13] 4-DEOXY-L-THREO-5-HEXOSULOSE-URONATE KETOL-
    6e-04  17%  1h3mA  [c.68.1.13] 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE
    7e-04  13%  1xjaA  [b.82.4.1] ARABINOSE OPERON REGULATORY PROTEIN
:478

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRQTKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAE
2cu2A2          ----KTYALVMAGGRGERLWPLSREDRPKPFLPLFEGKTLLEATLERLAPLVPPERTLLAVRRDQEAVAR
1pmiA           ----------IQCGYQNYDWGKSSSAVAQFVHNSDPSIDETKPYAELWMGTHPSVPSKAIDLNNQTLRDL
3bu7A1          ----------------------------------------------------------------------
1hrkA           --------------------------LPIQNLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVK
1qwrA           ----------------------------------------------------------------------
1fi2A           ----------------------------------------------------------------------
2atfA1          ----------------------------------------------------------------------
1sq4A           ----------------------------------------------------------------------
1jv1A           ISQNKVAVLLLAGGQGTRLGVAYPK-GMYDVGLP-SRKTLFQIQAERILKLQQVAEKYYGNKCIIPWYIM
1cauA           ----------------------------------------------------------------------
1qwjA           ----HLAALVLARGGSKGIP-------LKNIKRL-AGVPLIGWVLRAALDAGVFQSVWVSTDHDEIENVA
2gm6A1          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1ey2A           ----------------------------------------------------------------------
1tzfA           ----ASKAVILAGGLGVKPKPMVEI----------GGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEY
1j1lA           ----------------------------------------------------------------------
1j58A           ----------------------------------------------------------------------
1dzrA           ----------------------------------------------------------------------
1o4tA           ----------------------------------------------------------------------
1j3pA           ----------------------------------------------------------------------
1fxzA1          ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1vj2A           ----------------------------------------------------------------------
1fxzA2          ----------------------------------------------------------------------
1y9qA2          ----------------------------------------------------------------------
1yfuA1          ----------------------------------------------------------------------
1zrrA1          ----------------------------------------------------------------------
2pytA1          ----------------------------------------------------------------------
1gqgA           ----------------------------------------------------------------------
1w77A1          ----SVSVILLAGGSM-----------PKQYIPL-LGQPIALYSFFTFSRMPEVKEIVVVCDPFFRDIFE
2f4pA1          ----------------------------------------------------------------------
1lr5A           ----------------------------------------------------------------------
1e5kA           ---TTITGVVLAGGKARRMGG-----VDKGLLEL-NGKPLWQHVADALMTQLSHVVVNANRHQEIYQ---
1fwyA2          --------VILAAGKGTRMYS----DLPKVLHTL-AGKAMVQHVIDAANELGAAHVHLVYGHGGDLLK--
1v70A           ----------------------------------------------------------------------
1zz6A2          ----------------------------------------------------------------------
1rc6A           ----------------------------------------------------------------------
2cu2A1          ----------------------------------------------------------------------
1y3tA1          ----------------------------------------------------------------------
2b8mA1          ----------------------------------------------------------------------
1w55A1          ----EMSLIMLAAGNSTRF----NTKVKKQFLRL-GNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKF
1fxoA           --------IILAGGSGTRLHPATLA-ISKQLLPV-YDKPMIYYPLSTLMLAGIREILIISTPQD----TP
1yhfA1          ----------------------------------------------------------------------
1jykA           --------IILAAGLGTRLRPLTENT-PKALVQV-NQKPLIEYQIEFLKEKGINDIIIIVG---------
1vpaA           ------VAILLAAGKGERM----SENVPKQFLEI-EGRMLFEYPLSTFLKSEIDGVVIVTRREWFEVVEK
1o5uA           ----------------------------------------------------------------------
1wz8A1          ----------------------------------------------------------------------
1x8mA           ----------------------------------------------------------------------
1h3mA           ----DVCAVVPAAC-------------PKQYLSI-GNQTILEHSVHALLAHPVKRVVIAISPGDSRFAQL
1xjaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QLRQLNKLTENIILEPAGRNTXXXXXXXXXXXTRQHTDCDPLMLVLAADHAIANEEAFRDAVRGAMPYAD
2cu2A2          PYAD----GIRLLLEPLGRDTAGAVLLGVAEALKEGAER---LLVLPADHYVGDDEAYREALATMLEAAE
1pmiA           VTAKPQELGESIITKFGSSKELPFLFKVLSIEK------VLSIQAHPDKKLGAQLHAADPK------NYP
3bu7A1          ----------------------------------------------------------------------
1hrkA           LLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIA-FTQYPQYSCSTTGSSLNAIYRYYNQVG
1qwrA           ----------------------------------------------------------------------
1fi2A           ----------------------------------------------------------------------
2atfA1          ----------------------------------------------------------------------
1sq4A           ----------------------------------------------------------------------
1jv1A           TSGRTMESTKEFNVIFFQQGMPAMSFDGKIILEEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIH
1cauA           ----------------------------------------------------------------------
1qwjA           KQFGAQVH---RRSSETSKDSSTSLDAIVEF--LNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGY
2gm6A1          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1ey2A           ----------------------------------------------------------------------
1tzfA           FANYFLHMSDVENRMEVHHKRVEPWNVTLVDTGDSS--MTGGRLKRVAEYLFTYGDGVADLDIKATIDFH
1j1lA           ----------------------------------------------------------------------
1j58A           ----------------------------------------------------------------------
1dzrA           ----------------------------------------------------------------------
1o4tA           ----------------------------------------------------------------------
1j3pA           ----------------------------------------------------------------------
1fxzA1          ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1vj2A           ----------------------------------------------------------------------
1fxzA2          ----------------------------------------------------------------------
1y9qA2          ----------------------------------------------------------------------
1yfuA1          ----------------------------------------------------------------------
1zrrA1          ----------------------------------------------------------------------
2pytA1          ----------------------------------------------------------------------
1gqgA           ----------------------------------------------------------------------
1w77A1          EYEESIDVDLRFAIPGKERQDSVYSG-------LQEIDVNSELVCIHDSARPLVNTEDVEKVLKDGSAVG
2f4pA1          ----------------------------------------------------------------------
1lr5A           ----------------------------------------------------------------------
1e5kA           ----ASGLKVIEDSLADYPGPLAGMLSV-----MQQEAGEWFLFCPCDTPYIPPDLAARLN------HQR
1fwyA2          --QALKDDNLNWVLQAEQLGTGHAMQQA-----APFFADDEDILMLYGDVPLISVETLQRLRD----AKP
1v70A           ----------------------------------------------------------------------
1zz6A2          ----------------------------------------------------------------------
1rc6A           ----------------------------------------------------------------------
2cu2A1          ----------------------------------------------------------------------
1y3tA1          ----------------------------------------------------------------------
2b8mA1          ----------------------------------------------------------------------
1w55A1          TK--------NYEFIEGGDTR-----AESLKKALELIDSEF-VMVSDVARVLVSKNLFDRLIE---NLDK
1fxoA           RFQQLLGDGSNWGLDQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHD--FHELL-GSASQRQ
1yhfA1          ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
1vpaA           RVFHEKVLGIVEGGDTRSQSVRSALEFLEKFSPSYVLVHDSARPFLRKKHVSEVLRRARETGAAALKNSD
1o5uA           ----------------------------------------------------------------------
1wz8A1          -----------------------------------------LALALAADIAVVGKGT-----RLLDGH--
1x8mA           ----------------------------------------------------------------------
1h3mA           PLANHPQIT--VVDGGDERADSVLTG-------LKAAGDAQWVLVHDAARPCLHQDDLARLLALSETSRT
1xjaA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQFVEKPGLETAQAYVASGDYYWNSGMFLFRA
2cu2A2          EGFVVALGLRPTRPETEYGYIRLGPR-----EGAWYRGEGFVEKPSYAEALEYIRKG-YVWNGGVFAFAP
1pmiA           DDNHKPEMAIAVTDFEGFCGFKPLDQL----AKTLATVPELNEIIGQELVDEFISGI-KLPAEVGSQDDV
3bu7A1          -------------PELEAYYDDLAKIETGA---LWTVANDIEPWEPTPKSA------PVHWKWSREVLRA
1hrkA           RKPTMKWSTIDRWPTH-HLLI----------QCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRG
1qwrA           -------------------------------------TGECWAISAHPKGPSTVANGPYKGKTLIELWEE
1fi2A           ----------------------------------------------------------------------
2atfA1          ----------------------------------------------------------------------
1sq4A           ----------------------------------------------------------------------
1jv1A           VYCVDNILVKVADPRFIGFCIQKGADCGAKVVEKTNPVVEYSEIS-LATAQKRSSDGRNAGNIANHFFTV
1cauA           ----------------------------------------------------------------------
1qwjA           D----SVFSVVRRHQFRWSEIQKGVR---------EVTEPLNLNPA-KRPRRQDWDGELYENGSFYFAKR
2gm6A1          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1ey2A           ----------------------------------------------------------------------
1tzfA           KAHGKKATLTATFPPGRFGALDIQA----------GQVRSFQEKP--KGDGAMINGGFFVLNPSVIDLID
1j1lA           ----------------------------------------------------------------------
1j58A           ----------------------------------------------------------------------
1dzrA           ----------------------------------------------------------------------
1o4tA           ----------------------------------------------------------------------
1j3pA           ----------------------------------------------------------------------
1fxzA1          ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1vj2A           ----------------------------------------------------------------------
1fxzA2          ----------------------------------------------------------------------
1y9qA2          ----------------------------------------------------------------------
1yfuA1          ----------------------------------------------------------------------
1zrrA1          ----------------------------------------------------------------------
2pytA1          ----------------------------------------------------------------------
1gqgA           ----------------------------------------------------------------------
1w77A1          AAVLGVPAKATIKEVNSDSLVV---------------TLWEMQTPQVIKPELLKKGFELVKSEGLEVTDV
2f4pA1          ----------------------------------------------------------------------
1lr5A           ----------------------------------------------------------------------
1e5kA           KDAPVVWVHDGERDHPTIALVNRAIE---------PLLLEYLQAGERRVMVDFSDHKDAFVNVN------
1fwyA2          QGGIGLLTVKLDDP-TGYGRITREN----------GKVTGIVEHKDATDEQRQIQ----EINTGILIANG
1v70A           ----------------------------------------------------------------------
1zz6A2          ----------------------------------------------------------------------
1rc6A           ----------------------------------------------------------------------
2cu2A1          ----------------------------------------------------------------------
1y3tA1          ----------------------------------------------------------------------
2b8mA1          ----------------------------------------------------------------------
1w55A1          ADCITPALKVADTTLFDNEALQREKI----KLIQTPQISKTKLLKKALDQNLEF----TDDSTAIAAMGG
1fxoA           TG--ASVFAYHVLDPERYGVVEFDQ---------GGKAISLEEKPL---------------EPKSNYAVT
1yhfA1          ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
1vpaA           ALVRVENDRIEYIPRKG-----------------------------------------------------
1o5uA           ----------------------------------------------------------------------
1wz8A1          ----LRLGVAAG----DHAVLLWPLLVG---MAKAKYHLLLNEPLTGEEAER-LGLVALAVEDEKVYEKA
1x8mA           ----------------------------------------------------------------------
1h3mA           GGILAA------PVRDTMKRAEPGKNA----------IAHTVDRNGLWHALTP-----QFFPRE-LLHDC
1xjaA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRYLEELKKFRPDILAACEQAMRGVDPDLDFIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDV
2cu2A2          ATMAELFRRHLPSHHEALERLLAGASLE--------EVYAGLPKISIDYGVMEKAERVRVVLGRFPWDDV
1pmiA           NN-RKLLQKVFGK-------------------------LMNTDDDVIKQQTAKLLERTDREPQVFKDIDS
3bu7A1          IDLVRPEDAGRRVVYLRNPQRKDVSAACGWLFS----GIQTMKASALRFIMEGSGHKVELGANDFVLTPN
1hrkA           DPYPQEVSATVQKVMERLEYCNPYRLVWQSKVG-PMPWLGPQTDESIKGLCERGRKNILLVPIADHIETL
1qwrA           HREVFDRFPLLTKLLDVKEDTSIKVHPDDYYAGENEEGELGKTECWYIIDCKE-NAEIIYGHTARSKTEL
1fi2A           ----------------------------------------------------------------------
2atfA1          ----------------------------------------------------------------------
1sq4A           ----------------------------------------------------------------------
1jv1A           PFLRDVVNVYEPQLHHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPL
1cauA           ----------------------------------------------------------------------
1qwjA           HLIEMGYLQGGKMAYYEMRAEHSDIDVDIDWPIA-----------EQRVLRFGYFG--------------
2gm6A1          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
1ey2A           ----------------------------------------------------------------------
1tzfA           NDATTWEQEPLMTLAQQGELMAQPMDTLRDKVYLEGL---------------------------------
1j1lA           ----------------------------------------------------------------------
1j58A           --------------------------------------VTIVDEKGRSFIDDVGEGDLWYFPSGSIQALE
1dzrA           ----------------------------------------------------------------------
1o4tA           ----------------------------------------------------------------------
1j3pA           ----------------------------------------------------------------------
1fxzA1          ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1sfnA           ----------------------------------------------------------------------
1vj2A           ----------------------------------------------------------------------
1fxzA2          ----------------------------------------------------------------------
1y9qA2          ----------------------------------------------------------------------
1yfuA1          ----------------------------------------------------------------------
1zrrA1          ----------------------------------------------------------------------
2pytA1          ----------------------------------------------------------------------
1gqgA           ----------------------------------------------------------------------
1w77A1          SIVEYLKHPVYVSQGSYT---NIKVTTPDDLLLAERI---------------------------------
2f4pA1          ----------------------------------------------------------------------
1lr5A           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
1fwyA2          ADMKRWLAKLTNN---------------------------------------------------------
1v70A           ----------------------------------------------------------------------
1zz6A2          ----------------------------------------------------------------------
1rc6A           ----------------------------------------------------------------------
2cu2A1          ----------------------------------------------------------------------
1y3tA1          ----------------------------------------------------------------------
2b8mA1          ----------------------------------------------------------------------
1w55A1          KIWFVEGEENARKL--------------------------------------------------------
1fxoA           GLYF-----YDQQVVDIARDLKPSPRGELEITDV------------NRAYLERGQLSVEIMGRGYAWLDT
1yhfA1          ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
1vpaA           ----------------------------------------------------------------------
1o5uA           ----------------------------------------------------------------------
1wz8A1          LEVAERLAQGPKEALHHTKHALHWYRSFLPHFELSLALEFLG----------------------------
1x8mA           ----------------------------------------------------------------------
1h3mA           LTRALNEGATITDEASALEYCPQLVEGRADNIKVT-----------------------------------
1xjaA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GSWSSLWEISAHTPEGNVHHGDVISHKTENSYVYAESXXXXXXXXXXXXXXQTKDAVLIADRHAVQDVKK
2cu2A2          GNWRALERVFSQ----------------------------------------------------------
1pmiA           RLPELIQRLNKQFPNDIGLFCGVGLNKGEAMFLQAKDPHAYISGDIIECMAASDNVVRAGFTNLVEMLTY
3bu7A1          GTWHEHGILESGTECIWQDGLDIPLTNCLEANFYEPNDYQTTDIPLNDSPLTYGGPALLPQLDKWDKPYS
1hrkA           YELDIEYSQVLAKECGVENIRRAESLNGNPLFSKA-----------------------------------
1qwrA           VTXINSGDWEGLLRRIKIKPGDFYYVPSGTLHALCKGVLETQQNSDATYRVYDYDRLDSNGSPRELHFAK
1fi2A           ---------------------------------------------------VSVNGHTCKPMSEAGDDFL
2atfA1          ---------------------------------------------------RILHELFAGDEVNVEEVQA
1sq4A           ---------------------------------------------------HGGHPALLTDRAXFTEAYA
1jv1A           KNADSQNGKDNPTTARHALNAGGHFIDENGSRLPAIP--------RLKDANDVPIQCEISPLISYAGEGL
1cauA           -----------------------------------------------------------------QNNPY
1qwjA           ----------------------------------------------------------------------
2gm6A1          ---------------------------------------------------QPGEARILRE------GGA
1b0pA3          ---------------------------------------------------PDAERVIVSMGSSCETIEE
1ey2A           ----------------------------------------------------------------------
1tzfA           ----------------------------------------------------------------------
1j1lA           --------------------GDLQWXTAGRGILHAEXPCSEEPAHGLQLWVNLRSSEKXVEPQYQELKSE
1j58A           EGAEFLLVFDDGSFSENSTFQLTDWLAHTPKEVIAANFGVTKEEISNLPGKEKYIFENQLPGSLKDDIVE
1dzrA           ---------------------------------------------------------MIVIKTAIPDVLI
1o4tA           -------------------------------------------------------------------VVR
1j3pA           ----------------------------------------------------------KKSVRRLSDMKG
1fxzA1          ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1sfnA           --------------------------------------------------------------GSHAVITP
1vj2A           ----------------------------------------------------------------------
1fxzA2          -----------------------------------------------------------------MRLRH
1y9qA2          ----------------------------------------------------------------------
1yfuA1          -------------------------------------------------------------------MLT
1zrrA1          ----------------------------------------------------------------------
2pytA1          ----------------------------------------------------------------FTSVTG
1gqgA           ----------------------------------------------------------------------
1w77A1          ----------------------------------------------------------------------
2f4pA1          ----------------------------------------------------------------------
1lr5A           ----------------------------------------------------------------CVRDNS
1e5kA           ----------------------------------------------------------------------
1fwyA2          ----------------------------------------------------------------------
1v70A           ----------------------------------------------------------------------
1zz6A2          ----------------------------------------------------------------------
1rc6A           ---------------------------------------------------------LLANR-AIVKHGN
2cu2A1          --------------NVVLGEGRHVALDTFGCVVYADRGVVATLGVSGLVVAKVGDEVLVVPKDWAREVRE
1y3tA1          ----------------------------------------------------------------------
2b8mA1          ----------------------------------------------------------------------
1w55A1          ----------------------------------------------------------------------
1fxoA           GTHDSLLE--------------------------------------------------------------
1yhfA1          ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
1vpaA           ----------------------------------------------------------------------
1o5uA           ----------------------------------------------------------------------
1wz8A1          ----------------------------------------------------------------------
1x8mA           ----------------------------------------------------------------------
1h3mA           ----------------------------------------------------------------------
1xjaA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VVEKIKADGRHEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVT
2cu2A2          ----------------------------------------------------------------------
1pmiA           SYESVEKQKMPLQEFPRSKGDAVKSVLYDPPIAEFSVLQTIFDKSKGGKQVIEGLNGPSIVATNGKGTIQ
3bu7A1          PLLKYSWEPTYEAPYDGLILRYTNPQTGGHPMLTMGASMQMLRPGEHTKAH-RHTGNVIYNVAKGQGYSI
1hrkA           ----------------------------------------------------------------------
1qwrA           AVNAATVPHVDGYIDESTESRKGITIKTFVQGEYFSVYKWDINGEAEXA---QDESFLICSVIEGSGLLK
1fi2A           FSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVG
2atfA1          VLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLXILCWGEGHGSSIHDHTDSHCFLKLLQGNLKET
1sq4A           VIPKGVRDIVTSHLPFWDNXRXWVARPLSGFAETFSQYIVELAPNGGSDKPEQDPNAEAVLVVEGELSLT
1jv1A           ES--------------------------------------------------------------------
1cauA           LFRSNKFLTLFKQHGSLRLLQRFNEDTEKLENRDYRVLEYCSKPNTLL--LPHHSDSDLLVVLEGQAILV
1qwjA           ----------------------------------------------------------------------
2gm6A1          LLARLVARDDWLPDAFAQPHPEYYQQXLLDSAERFSIVSFVWGPGQRT--PIHDHTVWGLIVLDGSGRPV
1b0pA3          VINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASAKVITVLDRTKEPGAPPLYLDVCSAFVERGEAMPK
1ey2A           ---------SQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSXENRCFYNSDGDFLIVPQKGNLLIY
1tzfA           ----------------------------------------------------------------------
1j1lA           EIPKPSKDGVTVAVISGE---ALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIG
1j58A           GPNGEVPYPFTYRLLEQEPIESEGGKVYIADSTNIASALVTVEPGAXRELHWHPNTHEWQYYISGKARXT
1dzrA           LEPKVFGDERFESYNQQTFEELIG-----RKVTFVQDNHSKSKKNVLRGLHFQRGQGKLVRCAVGEVFDV
1o4tA           SSEITPERISNMRGGKGEVEMAHLLSKEAMHNKARLFARMKLPPGSSVGLHKHEGEFEIYYILLGEGVFH
1j3pA           YFID-EEAWKKMVEEGDPVVYEVYAIEQEEKEGDLNFATTVLYPGKVGNEFFKIDRAEVYFALKGKGGML
1fxzA1          -IQKLNALKPDNRESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPS-YTNGPQEIYIQQGKGIFG
1cauB           ---------------DPIYSNNYGKLYEITPDLDILLNCLQMNEGALFVPHYNSRATVILVANEGRAEVQ
1sfnA           ETFVRTALAEWPGSAIVLHIAPVV-----GLGARFVQFTAEMPAGAQ----ATESVYQRFAVLSGEVDVA
1vj2A           ILKRAYDVTPQKISTDKVRGVRKRVLIGLKDAPNFVMRLFTVEPGGLIDRH-SHPWEHEIFVLKGKLTVL
1fxzA2          NIGQTSSPDIYNPQAGS--VTTATSLDPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQ
1y9qA2          ---------------LNXKIHTLFPYAA---DTGLEIFEITLLDHHQQXSSPHALGVEYIHVLEGIXKVF
1yfuA1          YGAPFNFP--RWIDEHAHLLKPPVGNRQVW-QDSDFIVTVVGGPNHR--TDYHDDPLEEFFQLRGNAYLN
1zrrA1          -----------YQHAIDKLVAEKGYQSWDVISLRADNPQKEALREK--FLNEHTHGEEVRFFVEGAGLFC
2pytA1          KGGDGSSVKFGRFDGAEPHCVGLTDLVTEQDGSSXAAGFXQWDNAFF---PWTLNYDEIDXVLEGELHVR
1gqgA           -----HYSHARAVTVDTQLYRFYVTGPSSGYAFTLMGTNAPHSDALGVLPHIHQKHYENFYCNKGSFQLW
1w77A1          ----------------------------------------------------------------------
2f4pA1          ---------------GSSDFFTGNVWTDENGVFNTQVYDVVFEPGAR--THWHSHPGGQILVTRGKGFYQ
1lr5A           LVRDISQMPQSSYGIEGLSHITVA-GALNHGMKEVEVWLQTISPGQRTPIH-RHSCEEVFTVLKGKGTLL
1e5kA           ----------------------------------------------------------------------
1fwyA2          ----------------------------------------------------------------------
1v70A           -------------------------KIPVFQSERMLYDLYALLPGQAQKVHVHEGSDKVYYALEGEVVVR
1zz6A2          ---------------RPILKGVYYVYNCLKRAPSLVPLVVDVLTDNPDD--AKFNSGNEFLFVEGEIHMK
1rc6A           FALLTPDGLVKNIIPGFENCDATI-LSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLVISGNITAK
2cu2A1          VVKRLEA---------------------------------------------------------------
1y3tA1          -----------------------------STGDLFEIVLLSGGKGDAFPLHVHKDTHEGILVLDGKLELT
2b8mA1          --------------------------------EHVQINHIVLPRGEQXPKHYSNSYV-HLIIIKGEXTLT
1w55A1          ----------------------------------------------------------------------
1fxoA           ----------------------------------------------------------------------
1yhfA1          -------------------------------RQDLGITVFSLDKGQEIGR--HSSPGDAXVILSGLAEIT
1jykA           ----------------------------------------------------------------------
1vpaA           ----------------------------------------------------------------------
1o5uA           ---------------------------------------------------WYYDTNETCYILEGKVEVT
1wz8A1          ----------------------------------------------------------------------
1x8mA           ---------------------------------------VGGEVGKQLGVSYFLERRELGINIGGAGTIT
1h3mA           ----------------------------------------------------------------------
1xjaA           ----------------------------------------------------LGMKGYILLTIRGQGVVK


                         .         .         +         .         .         .         .:490
query           INGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDRYGRI
2cu2A2          ----------------------------------------------------------
1pmiA           IDSTKQKIDTGYVFFVAPGSSIELTADSANQDQDFTT---------------------
3bu7A1          VGGKRFDWSEHDIFCVPAWTWHEHCNTQERDDACLFSFNDFPVMEKLGFWAEQALED-
1hrkA           ----------------------------------------------------------
1qwrA           YEDKTCPLKKGDHFILPAQXPDF-TIKGTCTLIVSHI---------------------
1fi2A           ILGSSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDP-
2atfA1          LFKSERTLRENQCAYINDSGLHRVENVSHTPAVSLHLYSPPF---DTCHAFDQRTGHK
1sq4A           LQGQVHAXQPGGYAFIPPGADYKVRNTTGQHTRFHWIRKHYQKVDGVPLPEAFVT---
1jv1A           ----------------------------------------------------------
1cauA           LGRDTYKLDQGDAIKIQAGTPFYLINPDNNQN-LRILKFAITFRRPGTVEDFFLSST-
1qwjA           ----------------------------------------------------------
2gm6A1          LHGEPTRLGHVEAVSPTVGDIHRVHNAYDDVSISIHVYGANI-GGVRRSVYTEAGER-
1b0pA3          ILAGR--YGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDV---------------
1ey2A           TEFGKXLVQPNEICVIQRGXRFSIDVFEETRGYILEVYGVHFELPDLGPIGAN-----
1tzfA           ----------------------------------------------------------
1j1lA           PDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLI-AGEPLREPVI----------
1j58A           VHARTFNYQAGDVGYVPFAXGHYVENIGDEPLVFLEIFKDDHYADVSLNQW-------
1dzrA           AVGVNLSAENKRQLWIPEGFAHGFVTLSEYAE-FLYKATNYYSPSSESILWND-----
1o4tA           DNGKDVPIKAGDVCFTDSGESHSIENTGNTDLEFLAV---------------------
1j3pA           LEARFIEMEPGTIVYVPPYWAHRTINTGDKPFIFLALYPADA-GHDYGTIAEKGFSK-
1fxzA1          MHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLA-
1cauB           LRRYAATLSEGDIIVIPSSFPVALKAASDLNMVGIGVNAENNERNFLAGHKENVIRQI
1sfnA           VGGETRTLREYDYVYLPAGEKHMLTAKTDARVSVFEKPTVEGVQAPGVYWGNERENP-
1vj2A           KEQGEETVEEGFYIFVEPNEIHGFRNDTDSEVEFLCLIPK------------------
1fxzA2          VVNCDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTP-MIGTLAGANSLLNAL
1y9qA2          FDEQWHELQQGEHIRFFSDQPHGYAAVTEKAVFQNIVAY-------------------
1yfuA1          LRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHL
1zrrA1          LHVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDAQFTGDDIASAYP------
2pytA1          HEGETXIAKAGDVXFIPKGSSIEFGTPTSVRFLYVAWP--------------------
1gqgA           AQSQTRVLSSGDYGSVPRNVTHTFQIQDPDTEMTGVIVPGGFEDLFYYLGTNATDTTH
1w77A1          ----------------------------------------------------------
2f4pA1          RGKPARILKKGDVVEIPPNVVHWHGAAPDEELVHIGISTQVHLGPAEWLGTEEEYRK-
1lr5A           MGPQEIPFFQNTTFSIPVNDPHQVWNSDEHELVIISRPPAKIFLYDDWSM--------
1e5kA           ----------------------------------------------------------
1fwyA2          ----------------------------------------------------------
1v70A           VGEEEALLAPGMAAFAPAGAPHGVRNESASPALLLVV---------------------
1zz6A2          WGDKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIA---------------------
1rc6A           AEGKTFALSEGGYLYCPPGSLMTFVNAQA-----------------------------
2cu2A1          ----------------------------------------------------------
1y3tA1          LDGERYLLISGDYANIPAGTPHSYRMQS------------------------------
2b8mA1          LEDQEHNYKEGNIVYVPFNVKXLIQNINSDILEFFVVKA-------------------
1w55A1          ----------------------------------------------------------
1fxoA           ----------------------------------------------------------
1yhfA1          IDQETYRVAEGQTIVXPAGIPH------------------------------------
1jykA           ----------------------------------------------------------
1vpaA           ----------------------------------------------------------
1o5uA           TDGKKYVIEKGDLVTFPKGLRCRWKVLE------------------------------
1wz8A1          ----------------------------------------------------------
1x8mA           VDGQCYEIGHRDALYVGKGAKE------------------------------------
1h3mA           ----------------------------------------------------------
1xjaA           NQGREFVCRPGDILLFPPGEIHHYGRHP------------------------------