[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55041.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xvxA.bssp"
#ERROR : Can't open dsspfile "1xvyA.bssp"
#ERROR : Can't open dsspfile "1y4tD.bssp"
#ERROR : Can't open dsspfile "1y4tA.bssp"
#ERROR : Can't open dsspfile "2pt2A.bssp"
#ERROR : Can't open dsspfile "2pt1A.bssp"
#ERROR : Can't open dsspfile "1si0A.bssp"
#ERROR : Can't open dsspfile "1poy1.bssp"
#ERROR : Can't open dsspfile "1potA.bssp"
#ERROR : Can't open dsspfile "1q35A.bssp"
#ERROR : Can't open dsspfile "2vozB.bssp"
#ERROR : Can't open dsspfile "2vozA.bssp"
#ERROR : Can't open dsspfile "2o6aA.bssp"
#ERROR : Can't open dsspfile "1nnfA.bssp"

## Summary of PDB Search
:202
    4e-08  26%  1xvxA  [c.94.1] YFUA
    4e-07  26%  1xvyA  [c.94.1] SFUA
    5e-06  30%  1y4tD  [c.94.1] PUTATIVE IRON-UPTAKE ABC TRANSPORT SYSTEM
    5e-06  30%  1y4tA  [c.94.1] PUTATIVE IRON-UPTAKE ABC TRANSPORT SYSTEM
    1e-05  24%  2pt2A  [x.x.x] IRON TRANSPORT PROTEIN
    1e-05  24%  2pt1A  [x.x.x] IRON TRANSPORT PROTEIN
    1e-05  30%  1si0A  [c.94.1] IRON BINDING PROTEIN FBPA
    7e-05  26%  1poy1  [c.94.1] SPERMIDINE/PUTRESCINE-BINDING PROTEIN
    7e-05  26%  1potA  [x.x.x] SPERMIDINE/PUTRESCINE-BINDING PROTEIN
    1e-04  30%  1q35A  [c.94.1] IRON BINDING PROTEIN FBPA
    1e-04  25%  2vozB  [x.x.x] PERIPLASMIC IRON-BINDING PROTEIN
    1e-04  25%  2vozA  [x.x.x] PERIPLASMIC IRON-BINDING PROTEIN
    0.001  29%  2o6aA  [x.x.x] IRON-UTILIZATION PERIPLASMIC PROTEIN
    0.001  29%  1nnfA  [c.94.1] IRON-UTILIZATION PERIPLASMIC PROTEIN
:202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVVYSPNSEGLIGATIPAFEEKYGIKIELIQAGTGELFKKL
1xvxA           -----------------------------IVVYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQL
1xvyA           -----------------------------IVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQL
1y4tD           -----------------------------LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRL
1y4tA           -----------------------------LNIYSARHYNADFEIIKKFEEKTGIKVNHTQAKASELIKRL
2pt2A           -----------------------------------------------FTAETGIKVNLIEGKADELLERI
2pt1A           -----------------------------------------------FTAETGIKVNLIEGKADELLERI
1si0A           -------------------------------VYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKG-LVDRV
1poy1           ----------------------------------------------------------------------
1potA           ----------------------------------------------------------------------
1q35A           -------------------------------VYSYRQPYLIEPMLKNFEKDTGIKVNIIFADG--LVDRV
2vozB           -------------------------------------------TDDALYDAFG-EVNLIEASAEELIERI
2vozA           -------------------------------------------TDDALYDAFG-EVNLIEASAEELIERI
2o6aA           -----------------------------ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQL
1nnfA           -----------------------------ITVYNGQQKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQL


                         .         .         *         .         .         .         .:140
query           ESEKEVPVADVIFGGSYTQYATHGELFENYISKENDNVIKEYQNTTGFSTPYTLDGSVLIVHPDLTKGMN
1xvxA           VQEGSASPADVFLNSPAMVLVDNAKLFAPLDAVTQAQVAQEYRPEHGRWTGIAARSTVFVYNPEISEAEL
1xvyA           VQEGSASPADVFLNSPAMVLVDNAKLFAPLDAATLAQVEPQYRPSHGRWIGIAARSTVFVYNPKLSDAQL
1y4tD           SLEGSNSPADIFITADISNLTVSSKYLEEFIPAHLRDKDKEWFAITKRARIIAYNKNTNI---DISK---
1y4tA           SLEGSNSPADIFITADISNLTVSSKYLEEFIPAHLRDKDKEWFAITKRARIIAYNKNTNI---DISK---
2pt2A           KSEGANSPADVLLTVDLARLAEEDGIFQPVQSEILETNVPEYRSPDGMWFGFTKRARVIMYNKGKVKPEE
2pt1A           KSEGANSPADVLLTVDLARLAEEDGIFQPVQSEILETNVPEYRSPDGMWFGFTKRARVIMYNKGKVKPEE
1si0A           KQEGELSPADVLLTVDISRVMVNADLAQKIDSKVLENIPAQFRDSNDQWFGLTTRARVIYTSKDLPAGFD
1poy1           ----------------------------NFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGVNGDAVDPKS
1potA           ----------------------------NFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGVNGDAVDPKS
1q35A           KQEGELSPADVLLTVDISRVMVNADLAQKIDSKVLENIPAQFRDSNDQWFGLTTRARVIYTSKDLPAGFD
2vozB           QSEGANSPGDILFDAGMLWRAEQAGLFQPVRSKLNERIPENLRHPDGLWYGFTQRARVLYYSRDRVNPAD
2vozA           QSEGANSPGDILFDAGMLWRAEQAGLFQPVRSKLNERIPENLRHPDGLWYGFTQRARVLYYSRDRVNPAD
2o6aA           KEEGDKTPADVFY---TAQTATFADLSEGLLAPISEQTI---QQTAQKGVPIALSGRSRVVHTKLSEKDM
1nnfA           KEEGDKTPADVFY---TEQTATFADLSEGLLAPISEQTI---QQTAQKGVPIALSGRSRVVHTKLSEKDM


                         +         .         .         .         .         *         .:210
query           IEGYSDLLKPELKGKIATADPANSSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGxxx
1xvxA           PKSIMDLAKPEWKGRWAASP---SGADFQAIVSAMLELKGEKATLEWKAMKTNFTAYKG---
1xvyA           PKSLLDLAKPEWKGRWAASP---SGADFQAIVSALLELKGEKATLAWKAMKTNFTAYKG---
1y4tD           MKNYEDLAKAEFKGEIVSATAPYSKTLLASII----ANDGNKEAKAWA--------------
1y4tA           MKNYEDLAKAEFKGEIVSATAPYSKTLLASII----ANDGNKEAKAWA--------------
2pt2A           LSTYEELADPKWKGRVIIRSSSNEYN--QSLVASLVVADGEESTLAWA--------------
2pt1A           LSTYEELADPKWKGRVIIRSSSNEYN--QSLVASLVVADGEESTLAWA--------------
1si0A           ---YLDLAKPEYKGKVCVRSGKNS--------------------------------------
1poy1           VTSWADLWKPEYKGSLLLTDDAR--EVFQMALRKLGYSGNTTDPK-----------------
1potA           VTSWADLWKPEYKGSLLLTDDAR--EVFQMALRKLGYSGNTTDPK-----------------
1q35A           ---YLDLAKPEYKGKVCVRSGKNS--------------------------------------
2vozB           LSTYEALADPQWRGKILVRPSSN---------------------------------------
2vozA           LSTYEALADPQWRGKILVRPSSN---------------------------------------
2o6aA           EKSVLDYATPKWKGKIGY---VSTSGAFLEQVVALSKMKGDKVALNW---------------
1nnfA           EKSVLDYATPKWKGKIGY---VSTSGAFLEQVVALSKMKGDKVALNW---------------