[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55075.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "1ylfB.bssp"
#ERROR : Can't open dsspfile "1ylfC.bssp"
#ERROR : Can't open dsspfile "1ylfA.bssp"

## Summary of PDB Search
:145
    2e-22  45%  1xd7A  [a.4.5] YWNA
    3e-16  52%  1ylfB  [x.x.x] RRF2 FAMILY PROTEIN
    2e-15  50%  1ylfC  [x.x.x] RRF2 FAMILY PROTEIN
    2e-13  53%  1ylfA  [x.x.x] RRF2 FAMILY PROTEIN
:145

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xQIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGTEIVKDL
1xd7A           ----SRLAVAIHILSLISMDEKTS---SEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPGASLKKDP
1ylfB           ----SRFSIAVHILSILK-NNPSSLCTSDY-AESVNTNPVVIRKI-SYLKQAGFVYVNRGPGGAGLLKDL
1ylfC           --ISSRFSIAVHILSILK-NNPSSLCTSDY-AESVNTNPVVIRKI-SYLKQAGFVYVNRGPGGAGLLKDL
1ylfA           -KISSRFSIAVHILSILK-NNPSSLCTSDY-AESVNTNPVVIRKI-SYLKQAGFVYV---NGGAGLLKDL


                         .         .         *         .         .         .         .:140
query           KDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQLTMEAELGQTSLEKVVxxxx
1xd7A           ADISLLEVYRAVQ--------------KNPKCPVGKKIQNALDETFESVQRAMENELASKSLKDVM----
1ylfB           HEITLLDVYHAVNV-----------------CPIGANIQAVLEIILIQAQSAEE----------------
1ylfC           HEITLLDVYHAVN--------------------VGANIQAVLEQSAEEVLRNITGQLFETLQEK------
1ylfA           HEITLLDVYHAVNVIG------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxx
1xd7A           -----
1ylfB           -----
1ylfC           -----
1ylfA           -----