[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:sulB

[Show Plain Result]

#ERROR : Can't open dsspfile "1jbvA.bssp"
#ERROR : Can't open dsspfile "2gcaA.bssp"
#ERROR : Can't open dsspfile "1jbwA.bssp"
#ERROR : Can't open dsspfile "1o5zA.bssp"
#ERROR : Can't open dsspfile "2gcbA.bssp"
#ERROR : Can't open dsspfile "2gc6A.bssp"
#ERROR : Can't open dsspfile "2gc5A.bssp"
#ERROR : Can't open dsspfile "1fgsA.bssp"
#ERROR : Can't open dsspfile "1w78A.bssp"
#ERROR : Can't open dsspfile "1w7kA.bssp"
#ERROR : Can't open dsspfile "2vorA.bssp"
#ERROR : Can't open dsspfile "2vosA.bssp"

## Summary of PDB Search
:440
    5e-56  37%  1jbvA  [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE
    5e-56  37%  2gcaA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
    1e-54  36%  1jbwA  [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE
    2e-54  35%  1o5zA  [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE/DIHYDROFOLATE
    2e-54  37%  2gcbA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
    1e-53  36%  2gc6A  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
    4e-53  37%  2gc5A  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
    1e-49  37%  1fgsA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHETASE
    3e-33  34%  1w78A  [x.x.x] FOLC BIFUNCTIONAL PROTEIN
    6e-33  34%  1w7kA  [x.x.x] FOLC BIFUNCTIONAL PROTEIN
    6e-22  27%  2vorA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
    3e-18  28%  2vosA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
:440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIGGTNGKGSTIAFLKKMLEKLGLRVGV
1jbvA           -----------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGL
2gcaA           -----------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGL
1jbwA           -----------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGL
1o5zA           --------------------GLERISMLLSKLGNPHLEYKTIHIGGTNGKGSVANMVSNILVSQGYRVGS
2gcbA           -----------------------RILTLLHALGNPQQQGRYIHVTGTNGKSTAANAIAHVLEASGLTVGL
2gc6A           -----------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGL
2gc5A           -----------------------RILTLLHALGNPQQQGRYIHVTGTNGKSSAANAIAHVLEASGLTVGL
1fgsA           -----------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGL
1w78A           --------YLENLHSKTIDLGLERVSLVAARLGVLKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGV
1w7kA           --------WLS-YLENLIDLGLERVSLVAARLGVLKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGV
2vorA           ---------------------LTRISALMDLLGSPQRSYPSIHIAGTNGKTSVARMVDALVTALHRRTGR
2vosA           -------------------------ISALDLLGSPQRSYPSIHIAGTNGKTS-VARVDALVTALHRRTGR


                         .         .         *         .         .         .         .:140
query           FSSPYLIHYTDQISINGESISEARLEALMADYQSLLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAI
1jbvA           YTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADNVTEFEFITALAYWYFRQRQVDVAV
2gcaA           YTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADNVTEFEFITALGYWYFRQRQVDVAV
1jbwA           YTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADNVTEFEFITALAYWYFRQRQVDVAV
1o5zA           YYSPHLSTFRERIRLNEEYISEEDVVKIYETMEPILNELDKEEIFSPSFFEVVTAMAFLYFAEKNVDIAV
2gcbA           YTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADNVTEFEFITALGYWYFRQRQVDVAV
2gc6A           YTAPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADNVTEFEFITALGYWYFRQRQVDVAV
2gc5A           YTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADNVTEFEFITALGYWYFRQRQVDVAV
1fgsA           YTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADNVTEFEFITALAYWYFRQRQVDVAV
1w78A           YSSPHLVRYTERVRVQGQELPESAHTASFAEIES-ARGDI-----SLTYFEYGTLSALWLFKQAQLDVVI
1w7kA           YSSPHLVRYTERVRVQGQELPESAHTASFAEIES-ARGDI-----SLTYFEYGTLSALWLFKQAQLDVVI
2vorA           TTSPHLQSPVERISIDGKPISPAQYVATYREIEALIDQQSQAS-PAMSKFEVLTXXXXXXXXXXXXXXXX
2vosA           TTSPHLQSPVERISIDGKPISPAQYVATYREIEPLVAIDQQSQASPASKFEVLT-XXXXXXXXXXXXXXX


                         +         .         .         .         .         *         .:210
query           MEVGMGGLLDSTNVCQPILTGITTIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALTVIDRI
1jbvA           IEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPDXXXXXXXX
2gcaA           IEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPDXXXXXXXX
1jbwA           IEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPDXXXXXXXX
1o5zA           LEVGLGGRLDATNVVFPLCSTIVTVD-------RYTIEQIAWEKSGIIKERVPLVTGERKREALKVMEDV
2gcbA           IEVGIGGDTDSTNVITPVVSVLTSVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPDXXXXXXXX
2gc6A           IEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPDXXXXXXXX
2gc5A           IEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPDXXXXXXXX
1fgsA           IEVG-----DSTNVITPVVSVLTEVAL-------DTITAIAKHKAGIIKRGIPVVTGNLVPDXXXXXXXX
1w78A           LEVGLGGRLDATNIVDADVAVVTSIALDHTDWLGPDRESIG-REAGIFRSEKPAIVGE--PEMPSTIADV
1w7kA           LEVGLGGRLDATNIVDADVAVVTSIALDHTDWLGPDRESIG-REAGIFRSEKPAIVGE--PEMPSTIADV
2vorA           XXXXXXGRWDATNVINAPVAVITPISIDHVDYLXXXXXXXXXXXXXXXTRATVAVIGRQVPKVMEVLLAE
2vosA           XEVG-GGRWDATNVINAPVAVITPISIDHVDYLXXXXXXXXXXXXXXXTRATVAVIGRQVPK-VEVLLAE


                         .         .         .         +         .         .         .:280
query           AEEKDAPRLAYGTDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGRE
1jbvA           XXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYED--QDGRLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWP
2gcaA           XXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYED--QDGRLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWP
1jbwA           XXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYED--QDGRLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWP
1o5zA           ARKKSSRMYVIDKDFSVKVKSLKLHENRFDYCGENTFEDLVLTMNGPHQIENAGVALKTLEA----TGLP
2gcbA           XXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYED--QDGRLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWP
2gc6A           XXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYED--QDGRLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWP
2gc5A           XXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYED--QDGRLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWP
1fgsA           XXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYED--QDGRLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWP
1w78A           AQEKGALLQRRGVEWNYS-----VTDHDWAFSDA--HGTLENLPLPLVPQPN----XXXXXXXXXXSGLE
1w7kA           AQEKGALLQRRGVEWNYS-----VTDHDWAFSDA--HGTLENLPLPLVPQPN----XXXXXXXXXXSGLE
2vorA           SVRADASVAREDSEFAVRRQIAXXXXXXXXXXXXXXYSDIYLPLHGEHQAHNAVLALASVEAFAQLDG--
2vosA           SVRADASVAREDSEFAVRRQIAXXXXXXXXXXXXXXYSDIYLPLHGEHQAHNAVLALASVEAFAQLDG--


                         .         *         .         .         .         .         +:350
query           LASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADHHKEILFTCIKTKALED
1jbvA           LTPQN-IRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQ---------LFSQPITVIAGA
2gcaA           LTPQN-IRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQP-----ITVIAGILYAA
1jbwA           LTPQN-IRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFS-QPITVIAGILADKDYAA
1o5zA           L-SEKAIREGLKNAKNLGRFEILEKNGKMILDGAHNPHGAESLVRSLKLYFNGEPLSLVIGILDDKNRED
2gcbA           LTPQN-IRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQP--------ITVIAGIL
2gc6A           LTPQN-IRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQP-----ITVIAGILYAA
2gc5A           LTPQN-IRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFS---QPITVIAGIYAAMAD
1fgsA           LTPQN-IRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFSQP-----ITVIAGYAA--
1w78A           VSEN-AIRDGIASAILPGRFQIVSESPRVIFDVAHNPHAAEYL---------------------------
1w7kA           VSEN-AIRDGIASAILPGRFQIVSESPRVIFDVAHNPHAAEYL---------------------------
2vorA           ----DAVRAGFAAVTSPGRLERMRSAPTVFIDAAHNPAGASALAQTLAHEFDFRFLVGVLSVLGDKDVDG
2vosA           ----DAVRAGFAAVTSPGRLERRSA-PTVFIDAAHNPAGASALAQTLAHEFDFRFLVGVLSVLGDKDVDG


                         .         .         .         .         *         .         .:420
query           MLDLLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLEQNLTDKKEEKQTVRIVTGSLYF
1jbvA           MADRLTAAFSTVYLVPVPGTPRALPEARLKDS----------WQEALAASLNDVPDQP---IVITGSLYL
2gcaA           MADRLTAAFSTVYLVPVPGTPRALR---LKDS----------WQEALAASLNDVPDQP---IVITGSLYL
1jbwA           MADRLTAAFST-VYLVPVPGTRLKD----------------SWQEALAASLNDVPDQP---IVITGSLYL
1o5zA           ILRKYTGIFE-RVIVTRVPSPRMKDMNSLVDMAKKFFKNVEVIEDPLE-----AIESTERATVVTGSLFL
2gcbA           MADRLTAAFSTVYLVPVPGTPRALR---LKDS----------WQEALAASLNDVPDQP---IVITGSLYL
2gc6A           MADRLTAAFSTVYLVPVPGTPRALR---LKDS----------WQEALAASLNDVPDQP---IVITGSLYL
2gc5A           RLTYLVPVPGTPRALPRLKDS---------------------WQEALAASLNDVPDQP---IVITGSLYL
1fgsA           MADRLTAAFST----VYLVPVPGTPRGRLKDS----------WQEALAASLNDVPDQP---IVITGSLYL
1w78A           ----------------------------------------------------------------------
1w7kA           ----------------------------------------------------------------------
2vorA           ILAALEPVFDS-VVVTHNGSPRALDVEALALAAGER----------------------------------
2vosA           ILAALEPVFDS-VVVTHNGSPRALDVEALALAAGER----------------------------------


                         .         .         +         .         .         .         .:490
query           LSQVRAYLMERKxxxxxxxx
1jbvA           ASAVRQTLL-----------
2gcaA           ASAVRQTLL-----------
1jbwA           ASAVRQTLL-----------
1o5zA           VGYVREFLTTGK--------
2gcbA           ASAVRQTLL-----------
2gc6A           ASAVRQTLL-----------
2gc5A           ASAVRQTLL-----------
1fgsA           ASAVRQTLL-----------
1w78A           --------------------
1w7kA           --------------------
2vorA           --------------------
2vosA           --------------------