[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55169.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sczA.bssp"
#ERROR : Can't open dsspfile "1b5sA.bssp"
#ERROR : Can't open dsspfile "1c4tA.bssp"
#ERROR : Can't open dsspfile "1e2oA.bssp"
#ERROR : Can't open dsspfile "3b8kA.bssp"
#ERROR : Can't open dsspfile "1c4tB.bssp"
#ERROR : Can't open dsspfile "1c4tC.bssp"
#ERROR : Can't open dsspfile "1dpcA.bssp"
#ERROR : Can't open dsspfile "1dpdA.bssp"
#ERROR : Can't open dsspfile "1dpbA.bssp"
#ERROR : Can't open dsspfile "1eaaA.bssp"
#ERROR : Can't open dsspfile "2ihwA.bssp"
#ERROR : Can't open dsspfile "2eq9C.bssp"
#ERROR : Can't open dsspfile "2cooA.bssp"
#ERROR : Can't open dsspfile "1zwvA.bssp"
#ERROR : Can't open dsspfile "1w4iA.bssp"
#ERROR : Can't open dsspfile "1w88I.bssp"
#ERROR : Can't open dsspfile "1w85I.bssp"
#ERROR : Can't open dsspfile "1w3dA.bssp"
#ERROR : Can't open dsspfile "2pddA.bssp"
#ERROR : Can't open dsspfile "1ebdC.bssp"
#ERROR : Can't open dsspfile "3dv0J.bssp"
#ERROR : Can't open dsspfile "1w4gA.bssp"
#ERROR : Can't open dsspfile "1w4eA.bssp"
#ERROR : Can't open dsspfile "3dufJ.bssp"
#ERROR : Can't open dsspfile "3dufI.bssp"
#ERROR : Can't open dsspfile "1w4jA.bssp"
#ERROR : Can't open dsspfile "2eq8C.bssp"
#ERROR : Can't open dsspfile "2eq7C.bssp"
#ERROR : Can't open dsspfile "1zwvA.bssp"
#ERROR : Can't open dsspfile "2eq7C.bssp"

## Summary of PDB Search
:347
    1e-41  37%  1sczA  [c.43.1] DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
    3e-41  37%  1b5sA  [c.43.1] DIHYDROLIPOAMIDE ACETYLTRANSFERASE
    8e-40  37%  1c4tA  [c.43.1] PROTEIN (DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE)
    3e-39  37%  1e2oA  [x.x.x] DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
    1e-38  38%  3b8kA  [x.x.x] DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE
    1e-35  36%  1c4tB  [c.43.1] PROTEIN (DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE)
    2e-35  37%  1c4tC  [c.43.1] PROTEIN (DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE)
    3e-29  32%  1dpcA  [x.x.x] DIHYDROLIPOYL-TRANSACETYLASE
    3e-28  31%  1dpdA  [x.x.x] DIHYDROLIPOYL-TRANSACETYLASE
    2e-27  31%  1dpbA  [x.x.x] DIHYDROLIPOYL-TRANSACETYLASE
    1e-24  30%  1eaaA  [x.x.x] DIHYDROLIPOYL-TRANSACETYLASE
    5e-23  31%  2ihwA  [x.x.x] LIPOAMIDE ACYLTRANSFERASE COMPONENT OF BRANCHED-
    7e-07  58%  2eq9C  [x.x.x] PYRUVATE DEHYDROGENASE COMPLEX, DIHYDROLIPOAMIDE
    3e-06  45%  2cooA  [x.x.x] LIPOAMIDE ACYLTRANSFERASE COMPONENT OF BRANCHED-
    8e-06  51%  1zwvA  [x.x.x] LIPOAMIDE ACYLTRANSFERASE COMPONENT OF BRANCHED-
    1e-05  49%  1w4iA  [x.x.x] PYRUVATE DEHYDROGENASE E2
    5e-05  44%  1w88I  [a.9.1] DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE
    5e-05  44%  1w85I  [a.9.1] DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE
    5e-05  44%  1w3dA  [a.9.1] DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE
    5e-05  44%  2pddA  [x.x.x] DIHYDROLIPOAMIDE ACETYLTRANSFERASE
    5e-05  44%  1ebdC  [a.9.1] DIHYDROLIPOAMIDE ACETYLTRANSFERASE
    5e-05  44%  3dv0J  [x.x.x] DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE
    7e-05  44%  1w4gA  [x.x.x] DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE
    7e-05  44%  1w4eA  [x.x.x] DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE
    1e-04  47%  3dufJ  [x.x.x] DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE
    1e-04  47%  3dufI  [x.x.x] DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE
    1e-04  41%  1w4jA  [x.x.x] PYRUVATE DEHYDROGENASE E2
    4e-04  45%  2eq8C  [x.x.x] PYRUVATE DEHYDROGENASE COMPLEX, DIHYDROLIPOAMIDE
    6e-04  45%  2eq7C  [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E2 COMPONENT
    7e-05  42%  1zwvA  [x.x.x] LIPOAMIDE ACYLTRANSFERASE COMPONENT OF BRANCHED-(query 52->87)
    0.001  44%  2eq7C  [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E2 COMPONENT(query 53->84)
:347

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIALEHNIAWQEIQ
1sczA           ----------------------------------------------------------------------
1b5sA           ----------------------------------------------------------------------
1c4tA           ----------------------------------------------------------------------
1e2oA           ----------------------------------------------------------------------
3b8kA           ----------------------------------------------------------------------
1c4tB           ----------------------------------------------------------------------
1c4tC           ----------------------------------------------------------------------
1dpcA           ----------------------------------------------------------------------
1dpdA           ----------------------------------------------------------------------
1dpbA           ----------------------------------------------------------------------
1eaaA           ----------------------------------------------------------------------
2ihwA           ----------------------------------------------------------------------
2eq9C           -------AVPAARKLARELGIPIEEVPGSGPLGRVRVEDVRAYAE-------------------------
2cooA           ----KTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILP-----------------
1zwvA           ----KTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNY---------------------------
1w4iA           ----EVAAMPAARRLAKELGIDLSKVKGTGPGGVITVEDVKRY---------------------------
1w88I           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAF---------------------------
1w85I           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAF---------------------------
1w3dA           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAF---------------------------
2pddA           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAF---------------------------
1ebdC           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAF---------------------------
3dv0J           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAF---------------------------
1w4gA           -------AMPSVRKWAREKGVDIRLVQGTGKNGRVLKEDIDAF---------------------------
1w4eA           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAW---------------------------
3dufJ           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDID-----------------------------
3dufI           -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDID-----------------------------
1w4jA           ----EVAAMPAARRLAKELGIDASKVKGTGPGGVITVEDVKRWAE-------------------------
2eq8C           -------AAPSIRRLARELGVDLTRLRGTGLAGRITEEDV------------------------------
2eq7C           -------AMPAAERLMQEKGVSPAEVQGTGLGGRILKEDV------------------------------
1zwvA           ---------------------------------------------------TPAVRRLAMENNIKLSEVV
2eq7C           ----------------------------------------------------PAAERLMQEKGVSPAEVQ


                         .         .         *         .         .         .         .:140
query           GTGHRGKIMKKDVLALLxxxxxxxxxxxxxxxxxxxxxPDNVTPYGKIERIPMTPMRKVIAQRMVESYLT
1sczA           ------------------------------------------------KRVPMTRLRKRVAERLLEAKNS
1b5sA           -------------------------------------------------REKMSGIRRAIAKAMVHSKHT
1c4tA           ------------------------------------------------------PMRKRVAERLLEAKNS
1e2oA           ------------------------------------------------KRVPMTRLRKRVAERLLEAKNS
3b8kA           -------------------------------------------PTGVFTDIPISNIRRVIAQRLMQSKQT
1c4tB           --------------------------------------------------------RKRVAERLLEAKNS
1c4tC           ------------------------------------------------KRVP----RKRVAERLLEAKNS
1dpcA           --------------------------------------PVDFAKYGEIEEVPMTRLMQIGATNLHRSWLN
1dpdA           --------------------------------------PVDFAKYGEIEEVPMTRLMQIGATNLHRSWLN
1dpbA           --------------------------------------PVDFAKYGEIEEVPMTRLMQIGATNLHRSWLN
1eaaA           --------------------------------------PVDFAKYGEIEEVPMTRLMQIGATNLHRSWLN
2ihwA           ---------------------------------------------GKDRTEPVKGFHKAMVKTM-SAALK
2eq9C           ----------------------------------------------------------------------
2cooA           ----------------------------------------------------------------------
1zwvA           ----------------------------------------------------------------------
1w4iA           ----------------------------------------------------------------------
1w88I           ----------------------------------------------------------------------
1w85I           ----------------------------------------------------------------------
1w3dA           ----------------------------------------------------------------------
2pddA           ----------------------------------------------------------------------
1ebdC           ----------------------------------------------------------------------
3dv0J           ----------------------------------------------------------------------
1w4gA           ----------------------------------------------------------------------
1w4eA           ----------------------------------------------------------------------
3dufJ           ----------------------------------------------------------------------
3dufI           ----------------------------------------------------------------------
1w4jA           ----------------------------------------------------------------------
2eq8C           ----------------------------------------------------------------------
2eq7C           ----------------------------------------------------------------------
1zwvA           GSGKDGRILKEDILNYL-----------------------------------------------------
2eq7C           GTGLGGRILKEDVM--------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           APTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLLSLAVVKTLMKHPYINASLTEDGKTIITHNY
1sczA           TAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASI--DGDDVVYHNY
1b5sA           APHVTLMDEADVTKLVAHRKK-FKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHY
1c4tA           TAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASI--DGDDVVYHNY
1e2oA           TAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASI--DGDDVVYHNY
3b8kA           IPHYYLSIDVNMGEVLLVRKE-LNKILEGRSK-ISVNDFIIKASALACLKVPEANSSWMD---TVIRQNH
1c4tB           TAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASI------VVYHNY
1c4tC           TAMLTTFNEVNMKPIMDLRYG--EAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASI--DG--VVYHNY
1dpcA           VPHVTQFESADITELEAFRV-AQKAVAEKAGVKLTVXXXXXXXXXXXXXXXPDFNSSLAPSGQALIRKKY
1dpdA           VPHVTQFESADITELEAFRV-AQKAVAEKAGVKLTVXXXXXXXXXXXXXXXPDFNSSLAPSGQALIRKKY
1dpbA           VPHVTQFESADITELEAFRV-AQKAVAEKAGVKLTVXXXXXXXXXXXXXXXPDFNSSLAPSGQALIRKKY
1eaaA           VPHVTQFESADITELEAFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-PDFNSSLAPSGQALIRKKY
2ihwA           IPHFGYCDEVDLTELVKLREE-LKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKAS
2eq9C           ----------------------------------------------------------------------
2cooA           ----------------------------------------------------------------------
1zwvA           ----------------------------------------------------------------------
1w4iA           ----------------------------------------------------------------------
1w88I           ----------------------------------------------------------------------
1w85I           ----------------------------------------------------------------------
1w3dA           ----------------------------------------------------------------------
2pddA           ----------------------------------------------------------------------
1ebdC           ----------------------------------------------------------------------
3dv0J           ----------------------------------------------------------------------
1w4gA           ----------------------------------------------------------------------
1w4eA           ----------------------------------------------------------------------
3dufJ           ----------------------------------------------------------------------
3dufI           ----------------------------------------------------------------------
1w4jA           ----------------------------------------------------------------------
2eq8C           ----------------------------------------------------------------------
2eq7C           ----------------------------------------------------------------------
1zwvA           ----------------------------------------------------------------------
2eq7C           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VNLAMAVGMDNGLMTPVVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGP
1sczA           FDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
1b5sA           YNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTP
1c4tA           FDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
1e2oA           FDVSMAVS--TGLVTPVLRDVDTLGMADIEKKIKELAVKG-DGKLTVEDLTGGNFTITNGGVFGSLMSTP
3b8kA           VDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSA
1c4tB           FDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTV-DLTGGNFTITNGGVFGSLMSTP
1c4tC           FDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
1dpcA           VHIGFAVDTPDGLLVPVIRNVDXXXXXXXXXXXXXXXXXXXXXXXGADAMQGACFTISSLGHIGGTAFTP
1dpdA           VHIGFAVDTPDGLLVPVIRNVDXXXXXXXXXXXXXXXXXXXXXXXGADAMQGACFTIASLGHIGGTAFTP
1dpbA           VHIGFAVDTPDGLLVPVIRNVDXXXXXXXXXXXXXXXXXXXXXXXGADAMQGACFTISSLGHIGGTAFTP
1eaaA           VHIGFAVDTPDGLLVPVIRNVDXXXXXXXXXXXXXXXXXXXXXXXGADAMQGACFTISSLGHIGGTAFTP
2ihwA           HNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKP
2eq9C           ----------------------------------------------------------------------
2cooA           ----------------------------------------------------------------------
1zwvA           ----------------------------------------------------------------------
1w4iA           ----------------------------------------------------------------------
1w88I           ----------------------------------------------------------------------
1w85I           ----------------------------------------------------------------------
1w3dA           ----------------------------------------------------------------------
2pddA           ----------------------------------------------------------------------
1ebdC           ----------------------------------------------------------------------
3dv0J           ----------------------------------------------------------------------
1w4gA           ----------------------------------------------------------------------
1w4eA           ----------------------------------------------------------------------
3dufJ           ----------------------------------------------------------------------
3dufI           ----------------------------------------------------------------------
1w4jA           ----------------------------------------------------------------------
2eq8C           ----------------------------------------------------------------------
2eq7C           ----------------------------------------------------------------------
1zwvA           ----------------------------------------------------------------------
2eq7C           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IINQPNSAILGVSSTIEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI
1sczA           IINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL
1b5sA           VINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIKRLLSDPELLLM
1c4tA           IINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLL-
1e2oA           IINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL
3b8kA           IINPPQACILAIGASEDKLVPADNEFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL
1c4tB           IINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL
1c4tC           IINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL
1dpcA           IVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVIDGAAAARFTKRLGDLL--------
1dpdA           IVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLL--------
1dpbA           IVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDCRVINGAAAARFTKRLGDLL--------
1eaaA           IVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLL--------
2ihwA           VILPPEVAI-GALGTIKALPRFNGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLL
2eq9C           -------------------------------------------------------------------
2cooA           -------------------------------------------------------------------
1zwvA           -------------------------------------------------------------------
1w4iA           -------------------------------------------------------------------
1w88I           -------------------------------------------------------------------
1w85I           -------------------------------------------------------------------
1w3dA           -------------------------------------------------------------------
2pddA           -------------------------------------------------------------------
1ebdC           -------------------------------------------------------------------
3dv0J           -------------------------------------------------------------------
1w4gA           -------------------------------------------------------------------
1w4eA           -------------------------------------------------------------------
3dufJ           -------------------------------------------------------------------
3dufI           -------------------------------------------------------------------
1w4jA           -------------------------------------------------------------------
2eq8C           -------------------------------------------------------------------
2eq7C           -------------------------------------------------------------------
1zwvA           -------------------------------------------------------------------
2eq7C           -------------------------------------------------------------------