[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55177.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2vyuA.bssp"
#ERROR : Can't open dsspfile "2v05A.bssp"
#ERROR : Can't open dsspfile "2v04A.bssp"
#ERROR : Can't open dsspfile "2qj6A.bssp"
#ERROR : Can't open dsspfile "2g7cB.bssp"
#ERROR : Can't open dsspfile "2g7cA.bssp"
#ERROR : Can't open dsspfile "1gvmF.bssp"
#ERROR : Can't open dsspfile "1gvmE.bssp"
#ERROR : Can't open dsspfile "1gvmD.bssp"
#ERROR : Can't open dsspfile "1gvmB.bssp"
#ERROR : Can't open dsspfile "1gvmA.bssp"
#ERROR : Can't open dsspfile "2bmlB.bssp"
#ERROR : Can't open dsspfile "3hiaC.bssp"
#ERROR : Can't open dsspfile "1obaA.bssp"
#ERROR : Can't open dsspfile "2ixvA.bssp"
#ERROR : Can't open dsspfile "1h09A.bssp"
#ERROR : Can't open dsspfile "2bibA.bssp"
#ERROR : Can't open dsspfile "3hiaB.bssp"
#ERROR : Can't open dsspfile "3hiaA.bssp"

## Summary of PDB Search
:141
    9e-28  53%  2vyuA  [x.x.x] CHOLINE BINDING PROTEIN F
    9e-28  53%  2v05A  [x.x.x] CHOLINE BINDING PROTEIN F
    9e-28  53%  2v04A  [x.x.x] CHOLINE BINDING PROTEIN F
    2e-07  37%  2qj6A  [x.x.x] TOXIN A
    4e-05  35%  2g7cB  [x.x.x] TOXIN A
    5e-05  35%  2g7cA  [x.x.x] TOXIN A
    8e-05  40%  1gvmF  [b.109.1] AUTOLYSIN
    8e-05  40%  1gvmE  [b.109.1] AUTOLYSIN
    8e-05  40%  1gvmD  [b.109.1] AUTOLYSIN
    8e-05  40%  1gvmB  [b.109.1] AUTOLYSIN
    8e-05  40%  1gvmA  [b.109.1] AUTOLYSIN
    8e-05  40%  2bmlB  [x.x.x] AUTOLYSIN
    1e-04  47%  3hiaC  [x.x.x] CHOLINE BINDING PROTEIN
    2e-04  46%  1obaA  [c.1.8 - b.109.1] LYSOZYME
    2e-04  46%  2ixvA  [x.x.x] LYSOZYME
    2e-04  46%  1h09A  [c.1.8 - b.109.1] LYSOZYME
    3e-04  41%  2bibA  [x.x.x] TEICHOIC ACID PHOSPHORYLCHOLINE ESTERASE/
    5e-04  49%  3hiaB  [x.x.x] CHOLINE BINDING PROTEIN
    5e-04  49%  3hiaA  [x.x.x] CHOLINE BINDING PROTEIN
:141

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxTSTVFADDSEGWQFVQENGRTYYKKGDLKETYWRVIDGKYYYFDPLSGE
2vyuA           ----------------------------NTTGGRFVDKDNRKYYVKDDHKAIYWHKIDGKTYYFGDI-GE
2v05A           ----------------------------NTTGGRFVDKDNRKYYVKDDHKAIYWHKIDGKTYYFGDI-GE
2v04A           ----------------------------NTTGGRFVDKDNRKYYVKDDHKAIYWHKIDGKTYYFGDI-GE
2qj6A           ---------------------------------KFLTLNGKKYYFGSDSKATGLRTIDGKKYYFNTNTAV
2g7cB           ---------------------------------------------------TGMRTIDGKKYYFNTNTAE
2g7cA           ------------------------------------------------------RTIDGKKYYFNTNTAE
1gvmF           ---------------------------------KFEKINGTWYYSSGYMLADRWRKTDGNWYWFDN-SGE
1gvmE           ---------------------------------KFEKINGTWYYSSGYMLADRWRKTDGNWYWFDN-SGE
1gvmD           ---------------------------------KFEKINGTWYYSSGYMLADRWRKTDGNWYWFDN-SGE
1gvmB           ---------------------------------KFEKINGTWYYSSGYMLADRWRKTDGNWYWFDN-SGE
1gvmA           ---------------------------------KFEKINGTWYYSSGYMLADRWRKTDGNWYWFDN-SGE
2bmlB           ---------------------------------KFEKINGTWYYSSGYMLADRWRKTDGNWYWFDN-SGE
3hiaC           -------------------------------GW--VQVNGSWYYSNGSMKVNQWFQVGGKWYYVN-TSGE
1obaA           ---------------------TAGTWKQDSKGWWFRRNNGSFPYNK-------WEKIGGVWYYFD-----
2ixvA           ---------------------TAGTWKQDSKGWWFRRNNGSFPYNK-------WEKIGGVWYYFD-----
1h09A           ---------------------TAGTWKQDSKGWWFRRNNGSFPYNK-------WEKIGGVWYYFD-----
2bibA           -------------------------------GW--VQDKEQWYYLDVDSMKTGWLQYMGQWYYFAP-SGE
3hiaB           -------------------------------GW--VQVNGSWYYSNGSMKVNQWFQVGGKWYYVN-TSGE
3hiaA           -------------------------------GW--VQVNGSWYYSNGSMKVNQWFQVGGKWYYVN-TSGE


                         .         .         *         .         .         .         .:140
query           MVVGWQYIPAPHKGVTIGPSPRIEISLRPDWFYFGQDGVLQEFVGKQVLEAKTATNTNKHHGEEYDSPAE
2vyuA           MVVGWQYLEIPGTGYRFDNQPVNEIGLQEKWYYFGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAE
2v05A           MVVGWQYLEIPGTGYRFDNQPVNEIGLQEKWYYFGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAE
2v04A           MVVGWQYLEIPGTGYRFDNQPVNEIGLQEKWYYFGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAE
2qj6A           AVTGWQTINGKNTNTSIASTGYTIISGK--HFYFNTDGIMQVFKGPDGFEYFAPANTDANNIE-------
2g7cB           AATGWQTIDG--KKYYFNTNTSIASTINDKHFYFNTDGIMQVFKGPDGFEYFAPANTDANNIE-------
2g7cA           AATGWQTIDG--KKYYFNTNTSIASTINDKHFYFNTDGIMQVFKGPDGFEYFAPANTDANNIE-------
1gvmF           MATGWK-------------------KIADKWYYFNEEGAMK-----------------------------
1gvmE           MATGWK-------------------KIADKWYYFNEEGAMK-----------------------------
1gvmD           MATGWK-------------------KIADKWYYFNEEGAMK-----------------------------
1gvmB           MATGWK-------------------KIADKWYYFNEEGAMK-----------------------------
1gvmA           MATGWK-------------------KIADKWYYFNEEGAMK-----------------------------
2bmlB           MATGWK-------------------KIADKWYYFNEEGAMK-----------------------------
3hiaC           LAVNTSY---------------------------------------------------------------
1obaA           ----------------------------------------------------------------------
2ixvA           ----------------------------------------------------------------------
1h09A           ----------------------------------------------------------------------
2bibA           MKMGW-------------------VKDKETWYYMDSTGVMK-----------------------------
3hiaB           LAV-------------------------------------------------------------------
3hiaA           LAV-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           K
2vyuA           K
2v05A           K
2v04A           K
2qj6A           -
2g7cB           -
2g7cA           -
1gvmF           -
1gvmE           -
1gvmD           -
1gvmB           -
1gvmA           -
2bmlB           -
3hiaC           -
1obaA           -
2ixvA           -
1h09A           -
2bibA           -
3hiaB           -
3hiaA           -