[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55178.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3f69B.bssp"
#ERROR : Can't open dsspfile "2fumA.bssp"
#ERROR : Can't open dsspfile "2fumB.bssp"
#ERROR : Can't open dsspfile "1o6yA.bssp"
#ERROR : Can't open dsspfile "3f69A.bssp"
#ERROR : Can't open dsspfile "2fumD.bssp"
#ERROR : Can't open dsspfile "1mruB.bssp"
#ERROR : Can't open dsspfile "1mruA.bssp"
#ERROR : Can't open dsspfile "3f61A.bssp"
#ERROR : Can't open dsspfile "2fumC.bssp"
#ERROR : Can't open dsspfile "2biyA.bssp"
#ERROR : Can't open dsspfile "3hrfA.bssp"
#ERROR : Can't open dsspfile "2r3qA.bssp"
#ERROR : Can't open dsspfile "2r3iA.bssp"
#ERROR : Can't open dsspfile "1gz8A.bssp"
#ERROR : Can't open dsspfile "1uwhA.bssp"
#ERROR : Can't open dsspfile "3d4qA.bssp"
#ERROR : Can't open dsspfile "1vzoA.bssp"
#ERROR : Can't open dsspfile "3idpA.bssp"
#ERROR : Can't open dsspfile "2h9vA.bssp"
#ERROR : Can't open dsspfile "2fb8A.bssp"
#ERROR : Can't open dsspfile "2f2uB.bssp"
#ERROR : Can't open dsspfile "2f2uA.bssp"
#ERROR : Can't open dsspfile "2c30A.bssp"
#ERROR : Can't open dsspfile "1uwjA.bssp"
#ERROR : Can't open dsspfile "1uu7A.bssp"
#ERROR : Can't open dsspfile "1ykrA.bssp"
#ERROR : Can't open dsspfile "2wipC.bssp"
#ERROR : Can't open dsspfile "2wipA.bssp"
#ERROR : Can't open dsspfile "1vywC.bssp"
#ERROR : Can't open dsspfile "1vywA.bssp"
#ERROR : Can't open dsspfile "2vtrA.bssp"
#ERROR : Can't open dsspfile "1uwjB.bssp"
#ERROR : Can't open dsspfile "2r3hA.bssp"
#ERROR : Can't open dsspfile "2qnjB.bssp"
#ERROR : Can't open dsspfile "1okvC.bssp"
#ERROR : Can't open dsspfile "1okvA.bssp"
#ERROR : Can't open dsspfile "1oirA.bssp"
#ERROR : Can't open dsspfile "1jsvA.bssp"
#ERROR : Can't open dsspfile "1hckA.bssp"
#ERROR : Can't open dsspfile "1h0uA.bssp"
#ERROR : Can't open dsspfile "1h01A.bssp"
#ERROR : Can't open dsspfile "3f5xA.bssp"
#ERROR : Can't open dsspfile "1f5qC.bssp"
#ERROR : Can't open dsspfile "1f5qA.bssp"
#ERROR : Can't open dsspfile "3eocC.bssp"
#ERROR : Can't open dsspfile "3ej1C.bssp"
#ERROR : Can't open dsspfile "3ej1A.bssp"
#ERROR : Can't open dsspfile "1e1vA.bssp"
#ERROR : Can't open dsspfile "2ds1A.bssp"
#ERROR : Can't open dsspfile "2clxA.bssp"
#ERROR : Can't open dsspfile "2c6iA.bssp"
#ERROR : Can't open dsspfile "2c68A.bssp"
#ERROR : Can't open dsspfile "2c5yA.bssp"
#ERROR : Can't open dsspfile "2c4gC.bssp"
#ERROR : Can't open dsspfile "2c4gA.bssp"
#ERROR : Can't open dsspfile "1buhA.bssp"
#ERROR : Can't open dsspfile "2bkzC.bssp"
#ERROR : Can't open dsspfile "2a4lA.bssp"
#ERROR : Can't open dsspfile "1zrzA.bssp"
#ERROR : Can't open dsspfile "1okyA.bssp"
#ERROR : Can't open dsspfile "3hrcA.bssp"
#ERROR : Can't open dsspfile "3h9oA.bssp"
#ERROR : Can't open dsspfile "1h1wA.bssp"
#ERROR : Can't open dsspfile "1uu8A.bssp"
#ERROR : Can't open dsspfile "2qnjA.bssp"
#ERROR : Can't open dsspfile "3h4jA.bssp"
#ERROR : Can't open dsspfile "3h4jB.bssp"
#ERROR : Can't open dsspfile "1fotA.bssp"
#ERROR : Can't open dsspfile "2v55C.bssp"
#ERROR : Can't open dsspfile "2v55A.bssp"
#ERROR : Can't open dsspfile "3idpB.bssp"
#ERROR : Can't open dsspfile "2etkB.bssp"
#ERROR : Can't open dsspfile "2etkA.bssp"
#ERROR : Can't open dsspfile "1uu9A.bssp"
#ERROR : Can't open dsspfile "1okzA.bssp"
#ERROR : Can't open dsspfile "2hakE.bssp"
#ERROR : Can't open dsspfile "3eidC.bssp"
#ERROR : Can't open dsspfile "3c51B.bssp"
#ERROR : Can't open dsspfile "3c51A.bssp"
#ERROR : Can't open dsspfile "3c50B.bssp"
#ERROR : Can't open dsspfile "3c50A.bssp"
#ERROR : Can't open dsspfile "3c4zA.bssp"
#ERROR : Can't open dsspfile "3c4yB.bssp"
#ERROR : Can't open dsspfile "3c4yA.bssp"
#ERROR : Can't open dsspfile "3c4xB.bssp"
#ERROR : Can't open dsspfile "3c4xA.bssp"
#ERROR : Can't open dsspfile "3c4wB.bssp"
#ERROR : Can't open dsspfile "3c4wA.bssp"
#ERROR : Can't open dsspfile "2z7sA.bssp"
#ERROR : Can't open dsspfile "2z7rA.bssp"
#ERROR : Can't open dsspfile "2z7qA.bssp"
#ERROR : Can't open dsspfile "1z5mA.bssp"
#ERROR : Can't open dsspfile "1uu3A.bssp"
#ERROR : Can't open dsspfile "2r7bA.bssp"
#ERROR : Can't open dsspfile "2q0nA.bssp"
#ERROR : Can't open dsspfile "2j0iA.bssp"
#ERROR : Can't open dsspfile "2g9xC.bssp"
#ERROR : Can't open dsspfile "3eidA.bssp"
#ERROR : Can't open dsspfile "2cdzA.bssp"
#ERROR : Can't open dsspfile "2vd5B.bssp"
#ERROR : Can't open dsspfile "2uztA.bssp"
#ERROR : Can't open dsspfile "3fe3A.bssp"
#ERROR : Can't open dsspfile "3eqiA.bssp"
#ERROR : Can't open dsspfile "3eqfA.bssp"
#ERROR : Can't open dsspfile "1y91A.bssp"
#ERROR : Can't open dsspfile "3dbqA.bssp"
#ERROR : Can't open dsspfile "2bvaB.bssp"
#ERROR : Can't open dsspfile "2bvaA.bssp"
#ERROR : Can't open dsspfile "2zmcA.bssp"
#ERROR : Can't open dsspfile "1w98A.bssp"
#ERROR : Can't open dsspfile "1vyzA.bssp"
#ERROR : Can't open dsspfile "1oiyA.bssp"
#ERROR : Can't open dsspfile "1oiuC.bssp"
#ERROR : Can't open dsspfile "1oi9A.bssp"
#ERROR : Can't open dsspfile "1oguC.bssp"
#ERROR : Can't open dsspfile "1oguA.bssp"
#ERROR : Can't open dsspfile "1jsuA.bssp"
#ERROR : Can't open dsspfile "1jstA.bssp"
#ERROR : Can't open dsspfile "2jgzA.bssp"
#ERROR : Can't open dsspfile "2iw9C.bssp"
#ERROR : Can't open dsspfile "2iw9A.bssp"
#ERROR : Can't open dsspfile "2iw8C.bssp"
#ERROR : Can't open dsspfile "2iw8A.bssp"
#ERROR : Can't open dsspfile "2iw6C.bssp"
#ERROR : Can't open dsspfile "2iw6A.bssp"
#ERROR : Can't open dsspfile "1h27C.bssp"
#ERROR : Can't open dsspfile "1h26C.bssp"
#ERROR : Can't open dsspfile "1h25C.bssp"
#ERROR : Can't open dsspfile "1h24A.bssp"
#ERROR : Can't open dsspfile "1h0vA.bssp"
#ERROR : Can't open dsspfile "1h08A.bssp"
#ERROR : Can't open dsspfile "2g9xA.bssp"
#ERROR : Can't open dsspfile "3fz1A.bssp"
#ERROR : Can't open dsspfile "2f7xE.bssp"
#ERROR : Can't open dsspfile "1e9hA.bssp"
#ERROR : Can't open dsspfile "3dogC.bssp"
#ERROR : Can't open dsspfile "3dogA.bssp"
#ERROR : Can't open dsspfile "3ddqC.bssp"
#ERROR : Can't open dsspfile "3ddqA.bssp"
#ERROR : Can't open dsspfile "2cjmC.bssp"
#ERROR : Can't open dsspfile "2cjmA.bssp"
#ERROR : Can't open dsspfile "2cchA.bssp"
#ERROR : Can't open dsspfile "3bhuC.bssp"
#ERROR : Can't open dsspfile "3bhtC.bssp"
#ERROR : Can't open dsspfile "3bhtA.bssp"
#ERROR : Can't open dsspfile "2i40A.bssp"
#ERROR : Can't open dsspfile "2vtsA.bssp"
#ERROR : Can't open dsspfile "2vtoA.bssp"
#ERROR : Can't open dsspfile "2j4zB.bssp"
#ERROR : Can't open dsspfile "2j4zA.bssp"
#ERROR : Can't open dsspfile "2hakA.bssp"
#ERROR : Can't open dsspfile "3c4cA.bssp"
#ERROR : Can't open dsspfile "2vtiA.bssp"
#ERROR : Can't open dsspfile "2uznA.bssp"
#ERROR : Can't open dsspfile "1jvpP.bssp"
#ERROR : Can't open dsspfile "2iwiB.bssp"
#ERROR : Can't open dsspfile "2iwiA.bssp"
#ERROR : Can't open dsspfile "1fvtA.bssp"
#ERROR : Can't open dsspfile "2w06A.bssp"
#ERROR : Can't open dsspfile "2vtpA.bssp"
#ERROR : Can't open dsspfile "2vrxB.bssp"
#ERROR : Can't open dsspfile "2vgpB.bssp"
#ERROR : Can't open dsspfile "2vgpA.bssp"
#ERROR : Can't open dsspfile "2vgoB.bssp"
#ERROR : Can't open dsspfile "2vgoA.bssp"
#ERROR : Can't open dsspfile "1v0oB.bssp"
#ERROR : Can't open dsspfile "1v0oA.bssp"
#ERROR : Can't open dsspfile "1v0bA.bssp"
#ERROR : Can't open dsspfile "1mq4A.bssp"
#ERROR : Can't open dsspfile "3h10B.bssp"
#ERROR : Can't open dsspfile "3h10A.bssp"
#ERROR : Can't open dsspfile "2fvdA.bssp"
#ERROR : Can't open dsspfile "2f57B.bssp"
#ERROR : Can't open dsspfile "2f57A.bssp"
#ERROR : Can't open dsspfile "3e5aA.bssp"
#ERROR : Can't open dsspfile "1di8A.bssp"
#ERROR : Can't open dsspfile "2bfyB.bssp"
#ERROR : Can't open dsspfile "2bfyA.bssp"
#ERROR : Can't open dsspfile "2bfxB.bssp"
#ERROR : Can't open dsspfile "2bfxA.bssp"
#ERROR : Can't open dsspfile "2acxB.bssp"
#ERROR : Can't open dsspfile "2acxA.bssp"
#ERROR : Can't open dsspfile "2weiA.bssp"
#ERROR : Can't open dsspfile "2w7xA.bssp"
#ERROR : Can't open dsspfile "1j3hB.bssp"
#ERROR : Can't open dsspfile "1j3hA.bssp"
#ERROR : Can't open dsspfile "3gfwA.bssp"
#ERROR : Can't open dsspfile "2cn5A.bssp"
#ERROR : Can't open dsspfile "1wccA.bssp"
#ERROR : Can't open dsspfile "2vthA.bssp"
#ERROR : Can't open dsspfile "2r5tA.bssp"
#ERROR : Can't open dsspfile "1ol7A.bssp"
#ERROR : Can't open dsspfile "1ol5A.bssp"
#ERROR : Can't open dsspfile "1ke6A.bssp"
#ERROR : Can't open dsspfile "3hdnA.bssp"
#ERROR : Can't open dsspfile "3hdmA.bssp"
#ERROR : Can't open dsspfile "3ha6A.bssp"
#ERROR : Can't open dsspfile "1giiA.bssp"
#ERROR : Can't open dsspfile "3fxzA.bssp"
#ERROR : Can't open dsspfile "1ckpA.bssp"
#ERROR : Can't open dsspfile "1yhwA.bssp"
#ERROR : Can't open dsspfile "3ig7A.bssp"
#ERROR : Can't open dsspfile "3c4cB.bssp"
#ERROR : Can't open dsspfile "2bdwB.bssp"
#ERROR : Can't open dsspfile "2bdwA.bssp"
#ERROR : Can't open dsspfile "1zysA.bssp"
#ERROR : Can't open dsspfile "1yhvA.bssp"
#ERROR : Can't open dsspfile "1xh9A.bssp"
#ERROR : Can't open dsspfile "2wmxA.bssp"
#ERROR : Can't open dsspfile "2wmwA.bssp"
#ERROR : Can't open dsspfile "2wmvA.bssp"
#ERROR : Can't open dsspfile "2wmuA.bssp"
#ERROR : Can't open dsspfile "2wmtA.bssp"
#ERROR : Can't open dsspfile "2wmsA.bssp"
#ERROR : Can't open dsspfile "2wmrA.bssp"
#ERROR : Can't open dsspfile "2wmqA.bssp"
#ERROR : Can't open dsspfile "2r0uA.bssp"
#ERROR : Can't open dsspfile "2qhnA.bssp"
#ERROR : Can't open dsspfile "2ozaA.bssp"
#ERROR : Can't open dsspfile "1nvrA.bssp"
#ERROR : Can't open dsspfile "3jvsA.bssp"
#ERROR : Can't open dsspfile "3jvrA.bssp"
#ERROR : Can't open dsspfile "1ia8A.bssp"
#ERROR : Can't open dsspfile "2hogA.bssp"
#ERROR : Can't open dsspfile "1h0wA.bssp"
#ERROR : Can't open dsspfile "2gdoA.bssp"
#ERROR : Can't open dsspfile "3f9nA.bssp"
#ERROR : Can't open dsspfile "2e9nA.bssp"
#ERROR : Can't open dsspfile "3dxnA.bssp"
#ERROR : Can't open dsspfile "2cgxA.bssp"
#ERROR : Can't open dsspfile "2cgwA.bssp"
#ERROR : Can't open dsspfile "2cgvA.bssp"
#ERROR : Can't open dsspfile "2cguA.bssp"
#ERROR : Can't open dsspfile "2c3lA.bssp"
#ERROR : Can't open dsspfile "2c3kA.bssp"
#ERROR : Can't open dsspfile "2c3jA.bssp"
#ERROR : Can't open dsspfile "2brnA.bssp"
#ERROR : Can't open dsspfile "2brmA.bssp"
#ERROR : Can't open dsspfile "2brhA.bssp"
#ERROR : Can't open dsspfile "2brgA.bssp"
#ERROR : Can't open dsspfile "2aypA.bssp"
#ERROR : Can't open dsspfile "2zmdA.bssp"
#ERROR : Can't open dsspfile "1f3mC.bssp"
#ERROR : Can't open dsspfile "1ydrE.bssp"
#ERROR : Can't open dsspfile "2vu3A.bssp"
#ERROR : Can't open dsspfile "2vo6A.bssp"
#ERROR : Can't open dsspfile "2vo0A.bssp"
#ERROR : Can't open dsspfile "1v0bB.bssp"
#ERROR : Can't open dsspfile "2uw4A.bssp"
#ERROR : Can't open dsspfile "2uvzA.bssp"
#ERROR : Can't open dsspfile "2uvyA.bssp"
#ERROR : Can't open dsspfile "2uvxA.bssp"
#ERROR : Can't open dsspfile "1szmB.bssp"
#ERROR : Can't open dsspfile "1szmA.bssp"
#ERROR : Can't open dsspfile "1s9jA.bssp"
#ERROR : Can't open dsspfile "2r3nA.bssp"
#ERROR : Can't open dsspfile "2qluA.bssp"
#ERROR : Can't open dsspfile "1q61A.bssp"
#ERROR : Can't open dsspfile "2jdtA.bssp"
#ERROR : Can't open dsspfile "1h07A.bssp"
#ERROR : Can't open dsspfile "2fh9A.bssp"
#ERROR : Can't open dsspfile "3eqcA.bssp"
#ERROR : Can't open dsspfile "3e8nA.bssp"
#ERROR : Can't open dsspfile "3dv3A.bssp"
#ERROR : Can't open dsspfile "3dneA.bssp"
#ERROR : Can't open dsspfile "3dndA.bssp"
#ERROR : Can't open dsspfile "3d2iA.bssp"
#ERROR : Can't open dsspfile "1cmkE.bssp"
#ERROR : Can't open dsspfile "1cdkA.bssp"
#ERROR : Can't open dsspfile "2w17A.bssp"
#ERROR : Can't open dsspfile "2vv9A.bssp"
#ERROR : Can't open dsspfile "1s9iA.bssp"
#ERROR : Can't open dsspfile "2r3lA.bssp"
#ERROR : Can't open dsspfile "2r3kA.bssp"
#ERROR : Can't open dsspfile "2qkwB.bssp"
#ERROR : Can't open dsspfile "1ob3A.bssp"
#ERROR : Can't open dsspfile "1o6lA.bssp"
#ERROR : Can't open dsspfile "1o6kA.bssp"
#ERROR : Can't open dsspfile "2nryC.bssp"
#ERROR : Can't open dsspfile "2jdoA.bssp"
#ERROR : Can't open dsspfile "3e8dB.bssp"
#ERROR : Can't open dsspfile "3e8dA.bssp"
#ERROR : Can't open dsspfile "3e88A.bssp"
#ERROR : Can't open dsspfile "3e87A.bssp"
#ERROR : Can't open dsspfile "3dy7A.bssp"
#ERROR : Can't open dsspfile "3d15A.bssp"
#ERROR : Can't open dsspfile "3d0eA.bssp"
#ERROR : Can't open dsspfile "1xo2B.bssp"
#ERROR : Can't open dsspfile "1xh8A.bssp"
#ERROR : Can't open dsspfile "1xh7A.bssp"
#ERROR : Can't open dsspfile "1xh6A.bssp"
#ERROR : Can't open dsspfile "1u7eA.bssp"
#ERROR : Can't open dsspfile "1stcE.bssp"
#ERROR : Can't open dsspfile "1smhA.bssp"
#ERROR : Can't open dsspfile "1rejA.bssp"
#ERROR : Can't open dsspfile "2r3jA.bssp"
#ERROR : Can't open dsspfile "2qvsE.bssp"
#ERROR : Can't open dsspfile "2qurA.bssp"
#ERROR : Can't open dsspfile "2qcsA.bssp"
#ERROR : Can't open dsspfile "1qcfA.bssp"
#ERROR : Can't open dsspfile "1q8wA.bssp"
#ERROR : Can't open dsspfile "1q8uA.bssp"
#ERROR : Can't open dsspfile "1q8tA.bssp"
#ERROR : Can't open dsspfile "1pmqA.bssp"
#ERROR : Can't open dsspfile "1p2aA.bssp"
#ERROR : Can't open dsspfile "2oicD.bssp"
#ERROR : Can't open dsspfile "2oibD.bssp"
#ERROR : Can't open dsspfile "1muoA.bssp"
#ERROR : Can't open dsspfile "1l3rE.bssp"
#ERROR : Can't open dsspfile "1jowB.bssp"
#ERROR : Can't open dsspfile "1jbpE.bssp"
#ERROR : Can't open dsspfile "3idbA.bssp"
#ERROR : Can't open dsspfile "3hztA.bssp"
#ERROR : Can't open dsspfile "2hk5A.bssp"
#ERROR : Can't open dsspfile "3hgkC.bssp"
#ERROR : Can't open dsspfile "3hgkB.bssp"
#ERROR : Can't open dsspfile "3hgkA.bssp"
#ERROR : Can't open dsspfile "2h34A.bssp"
#ERROR : Can't open dsspfile "1h00A.bssp"
#ERROR : Can't open dsspfile "2gu8A.bssp"
#ERROR : Can't open dsspfile "1gijA.bssp"
#ERROR : Can't open dsspfile "1gihA.bssp"
#ERROR : Can't open dsspfile "1g3nA.bssp"
#ERROR : Can't open dsspfile "1fmoE.bssp"
#ERROR : Can't open dsspfile "3fjqE.bssp"
#ERROR : Can't open dsspfile "3fhiA.bssp"
#ERROR : Can't open dsspfile "2f2cB.bssp"
#ERROR : Can't open dsspfile "2eufB.bssp"
#ERROR : Can't open dsspfile "3e8eI.bssp"
#ERROR : Can't open dsspfile "3e8cE.bssp"
#ERROR : Can't open dsspfile "3e8cB.bssp"
#ERROR : Can't open dsspfile "3dakD.bssp"
#ERROR : Can't open dsspfile "1ctpE.bssp"
#ERROR : Can't open dsspfile "2cpkE.bssp"
#ERROR : Can't open dsspfile "2c1aA.bssp"
#ERROR : Can't open dsspfile "3bwjA.bssp"
#ERROR : Can't open dsspfile "1blxA.bssp"
#ERROR : Can't open dsspfile "1bkxA.bssp"
#ERROR : Can't open dsspfile "1bi8A.bssp"
#ERROR : Can't open dsspfile "1bi7A.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "2yzaA.bssp"
#ERROR : Can't open dsspfile "2w1eA.bssp"
#ERROR : Can't open dsspfile "2vwiC.bssp"
#ERROR : Can't open dsspfile "1urwA.bssp"
#ERROR : Can't open dsspfile "1oitA.bssp"
#ERROR : Can't open dsspfile "2nruB.bssp"
#ERROR : Can't open dsspfile "2nruA.bssp"
#ERROR : Can't open dsspfile "3hmmA.bssp"
#ERROR : Can't open dsspfile "2gnlA.bssp"
#ERROR : Can't open dsspfile "2gnjA.bssp"
#ERROR : Can't open dsspfile "2gngA.bssp"
#ERROR : Can't open dsspfile "2gnfA.bssp"
#ERROR : Can't open dsspfile "3fdnA.bssp"
#ERROR : Can't open dsspfile "3dj5A.bssp"
#ERROR : Can't open dsspfile "3bhhD.bssp"
#ERROR : Can't open dsspfile "3bhhC.bssp"
#ERROR : Can't open dsspfile "3bhhB.bssp"
#ERROR : Can't open dsspfile "3bhhA.bssp"
#ERROR : Can't open dsspfile "2welA.bssp"
#ERROR : Can't open dsspfile "2w1gA.bssp"
#ERROR : Can't open dsspfile "2w1fA.bssp"
#ERROR : Can't open dsspfile "2vn9A.bssp"
#ERROR : Can't open dsspfile "1q62A.bssp"
#ERROR : Can't open dsspfile "1q24A.bssp"
#ERROR : Can't open dsspfile "3i79A.bssp"
#ERROR : Can't open dsspfile "3hx4A.bssp"
#ERROR : Can't open dsspfile "2hakD.bssp"
#ERROR : Can't open dsspfile "2hakC.bssp"
#ERROR : Can't open dsspfile "3dj7A.bssp"
#ERROR : Can't open dsspfile "3d14A.bssp"
#ERROR : Can't open dsspfile "2c6dA.bssp"
#ERROR : Can't open dsspfile "2vz6B.bssp"
#ERROR : Can't open dsspfile "2vz6A.bssp"
#ERROR : Can't open dsspfile "1sykB.bssp"
#ERROR : Can't open dsspfile "1sykA.bssp"
#ERROR : Can't open dsspfile "2qg5D.bssp"
#ERROR : Can't open dsspfile "2qg5B.bssp"
#ERROR : Can't open dsspfile "2qg5A.bssp"
#ERROR : Can't open dsspfile "2oibC.bssp"
#ERROR : Can't open dsspfile "3faaA.bssp"
#ERROR : Can't open dsspfile "3f3zA.bssp"
#ERROR : Can't open dsspfile "3c0iA.bssp"
#ERROR : Can't open dsspfile "3c0hA.bssp"
#ERROR : Can't open dsspfile "3c0gB.bssp"
#ERROR : Can't open dsspfile "3c0gA.bssp"
#ERROR : Can't open dsspfile "2w05A.bssp"
#ERROR : Can't open dsspfile "1ob3B.bssp"
#ERROR : Can't open dsspfile "2nryA.bssp"
#ERROR : Can't open dsspfile "2np8A.bssp"
#ERROR : Can't open dsspfile "1g5sA.bssp"
#ERROR : Can't open dsspfile "3ezvA.bssp"
#ERROR : Can't open dsspfile "1aq1A.bssp"
#ERROR : Can't open dsspfile "1zycA.bssp"
#ERROR : Can't open dsspfile "2vd5A.bssp"
#ERROR : Can't open dsspfile "1v1kA.bssp"
#ERROR : Can't open dsspfile "2pmiC.bssp"
#ERROR : Can't open dsspfile "2pmiA.bssp"
#ERROR : Can't open dsspfile "2pk9C.bssp"
#ERROR : Can't open dsspfile "2pk9A.bssp"
#ERROR : Can't open dsspfile "2oidD.bssp"
#ERROR : Can't open dsspfile "2oidA.bssp"
#ERROR : Can't open dsspfile "2oibB.bssp"
#ERROR : Can't open dsspfile "2oibA.bssp"
#ERROR : Can't open dsspfile "2j50A.bssp"
#ERROR : Can't open dsspfile "3h9fA.bssp"
#ERROR : Can't open dsspfile "3h10D.bssp"
#ERROR : Can't open dsspfile "2btrA.bssp"
#ERROR : Can't open dsspfile "1zycB.bssp"
#ERROR : Can't open dsspfile "2w5bA.bssp"
#ERROR : Can't open dsspfile "2vtjA.bssp"
#ERROR : Can't open dsspfile "3fpmA.bssp"
#ERROR : Can't open dsspfile "3e7oA.bssp"
#ERROR : Can't open dsspfile "2duvA.bssp"
#ERROR : Can't open dsspfile "2c6eA.bssp"
#ERROR : Can't open dsspfile "2b52A.bssp"
#ERROR : Can't open dsspfile "1zy4A.bssp"
#ERROR : Can't open dsspfile "1ym7D.bssp"
#ERROR : Can't open dsspfile "1ym7C.bssp"
#ERROR : Can't open dsspfile "1ym7A.bssp"
#ERROR : Can't open dsspfile "1y57A.bssp"
#ERROR : Can't open dsspfile "2srcA.bssp"
#ERROR : Can't open dsspfile "2r0iA.bssp"
#ERROR : Can't open dsspfile "1omwA.bssp"
#ERROR : Can't open dsspfile "2nryD.bssp"
#ERROR : Can't open dsspfile "1mryA.bssp"
#ERROR : Can't open dsspfile "1kswA.bssp"
#ERROR : Can't open dsspfile "2h8hA.bssp"
#ERROR : Can't open dsspfile "3cikA.bssp"
#ERROR : Can't open dsspfile "3cekA.bssp"
#ERROR : Can't open dsspfile "2bcjA.bssp"
#ERROR : Can't open dsspfile "1zydB.bssp"
#ERROR : Can't open dsspfile "1zycD.bssp"
#ERROR : Can't open dsspfile "1zycC.bssp"
#ERROR : Can't open dsspfile "2wouA.bssp"
#ERROR : Can't open dsspfile "2wotA.bssp"
#ERROR : Can't open dsspfile "2wajA.bssp"
#ERROR : Can't open dsspfile "2vtqA.bssp"
#ERROR : Can't open dsspfile "2v7oA.bssp"
#ERROR : Can't open dsspfile "1py5A.bssp"
#ERROR : Can't open dsspfile "1ny3A.bssp"
#ERROR : Can't open dsspfile "2jamB.bssp"
#ERROR : Can't open dsspfile "2jamA.bssp"
#ERROR : Can't open dsspfile "1iasA.bssp"
#ERROR : Can't open dsspfile "2h6dA.bssp"
#ERROR : Can't open dsspfile "3g33A.bssp"
#ERROR : Can't open dsspfile "2bmcF.bssp"
#ERROR : Can't open dsspfile "2bmcC.bssp"
#ERROR : Can't open dsspfile "2bmcB.bssp"
#ERROR : Can't open dsspfile "2bmcA.bssp"
#ERROR : Can't open dsspfile "1b6cB.bssp"
#ERROR : Can't open dsspfile "2b55A.bssp"
#ERROR : Can't open dsspfile "2zdtA.bssp"
#ERROR : Can't open dsspfile "1wmkH.bssp"
#ERROR : Can't open dsspfile "1wmkB.bssp"
#ERROR : Can't open dsspfile "1wmkE.bssp"
#ERROR : Can't open dsspfile "1wmkA.bssp"
#ERROR : Can't open dsspfile "2vttA.bssp"
#ERROR : Can't open dsspfile "2vtnA.bssp"
#ERROR : Can't open dsspfile "1rdqE.bssp"
#ERROR : Can't open dsspfile "1r78A.bssp"
#ERROR : Can't open dsspfile "2pzyB.bssp"
#ERROR : Can't open dsspfile "1pmvA.bssp"
#ERROR : Can't open dsspfile "1pmnA.bssp"
#ERROR : Can't open dsspfile "2pl0A.bssp"
#ERROR : Can't open dsspfile "2p33A.bssp"
#ERROR : Can't open dsspfile "2oidC.bssp"
#ERROR : Can't open dsspfile "2oidB.bssp"
#ERROR : Can't open dsspfile "2oicB.bssp"
#ERROR : Can't open dsspfile "2oicA.bssp"
#ERROR : Can't open dsspfile "2of2A.bssp"
#ERROR : Can't open dsspfile "1jnkA.bssp"
#ERROR : Can't open dsspfile "2jedB.bssp"
#ERROR : Can't open dsspfile "2jedA.bssp"
#ERROR : Can't open dsspfile "2j9mA.bssp"
#ERROR : Can't open dsspfile "3g9nA.bssp"
#ERROR : Can't open dsspfile "3g90X.bssp"
#ERROR : Can't open dsspfile "3dakC.bssp"
#ERROR : Can't open dsspfile "2btsA.bssp"
#ERROR : Can't open dsspfile "2bheA.bssp"
#ERROR : Can't open dsspfile "2a27A.bssp"
#ERROR : Can't open dsspfile "2w9fB.bssp"
#ERROR : Can't open dsspfile "2w1dA.bssp"
#ERROR : Can't open dsspfile "1oiqA.bssp"
#ERROR : Can't open dsspfile "2dwbA.bssp"
#ERROR : Can't open dsspfile "1zwsA.bssp"
#ERROR : Can't open dsspfile "2w96B.bssp"
#ERROR : Can't open dsspfile "2w0jA.bssp"
#ERROR : Can't open dsspfile "1vjyA.bssp"
#ERROR : Can't open dsspfile "2ow3B.bssp"
#ERROR : Can't open dsspfile "2ow3A.bssp"
#ERROR : Can't open dsspfile "1o9uA.bssp"
#ERROR : Can't open dsspfile "2o0uA.bssp"
#ERROR : Can't open dsspfile "2jbpG.bssp"
#ERROR : Can't open dsspfile "2jbpC.bssp"
#ERROR : Can't open dsspfile "3igoA.bssp"
#ERROR : Can't open dsspfile "1iasB.bssp"
#ERROR : Can't open dsspfile "2i0eB.bssp"
#ERROR : Can't open dsspfile "2i0eA.bssp"
#ERROR : Can't open dsspfile "1gngB.bssp"
#ERROR : Can't open dsspfile "1gngA.bssp"
#ERROR : Can't open dsspfile "3f88A.bssp"
#ERROR : Can't open dsspfile "3f7zB.bssp"
#ERROR : Can't open dsspfile "3f7zA.bssp"
#ERROR : Can't open dsspfile "2ckeB.bssp"
#ERROR : Can't open dsspfile "2ckeA.bssp"
#ERROR : Can't open dsspfile "2c47D.bssp"
#ERROR : Can't open dsspfile "2a2aB.bssp"
#ERROR : Can't open dsspfile "2a2aA.bssp"
#ERROR : Can't open dsspfile "2vwiD.bssp"
#ERROR : Can't open dsspfile "2v5qA.bssp"
#ERROR : Can't open dsspfile "1s9iB.bssp"
#ERROR : Can't open dsspfile "1q3wB.bssp"
#ERROR : Can't open dsspfile "3gxlA.bssp"
#ERROR : Can't open dsspfile "3gbzA.bssp"
#ERROR : Can't open dsspfile "1f3mD.bssp"
#ERROR : Can't open dsspfile "3cqwA.bssp"
#ERROR : Can't open dsspfile "3cquA.bssp"
#ERROR : Can't open dsspfile "1zydA.bssp"
#ERROR : Can't open dsspfile "2w9zB.bssp"
#ERROR : Can't open dsspfile "2w99B.bssp"
#ERROR : Can't open dsspfile "1ukiA.bssp"
#ERROR : Can't open dsspfile "2o8yB.bssp"
#ERROR : Can't open dsspfile "2jbpH.bssp"
#ERROR : Can't open dsspfile "3hyhA.bssp"
#ERROR : Can't open dsspfile "2h96A.bssp"
#ERROR : Can't open dsspfile "3h0zA.bssp"
#ERROR : Can't open dsspfile "3h0yA.bssp"
#ERROR : Can't open dsspfile "2gmxB.bssp"
#ERROR : Can't open dsspfile "2gmxA.bssp"
#ERROR : Can't open dsspfile "2g01B.bssp"
#ERROR : Can't open dsspfile "2g01A.bssp"
#ERROR : Can't open dsspfile "3famB.bssp"
#ERROR : Can't open dsspfile "2eueB.bssp"
#ERROR : Can't open dsspfile "2c47B.bssp"
#ERROR : Can't open dsspfile "2c47A.bssp"
#ERROR : Can't open dsspfile "3bqrA.bssp"
#ERROR : Can't open dsspfile "2zduA.bssp"
#ERROR : Can't open dsspfile "1yxsA.bssp"
#ERROR : Can't open dsspfile "1ywvA.bssp"
#ERROR : Can't open dsspfile "1xwsA.bssp"
#ERROR : Can't open dsspfile "1xqzA.bssp"
#ERROR : Can't open dsspfile "2qkrA.bssp"
#ERROR : Can't open dsspfile "2ok1A.bssp"
#ERROR : Can't open dsspfile "2o2uA.bssp"
#ERROR : Can't open dsspfile "2jfmA.bssp"
#ERROR : Can't open dsspfile "3hyhB.bssp"
#ERROR : Can't open dsspfile "3gqiA.bssp"
#ERROR : Can't open dsspfile "3famA.bssp"
#ERROR : Can't open dsspfile "2excX.bssp"
#ERROR : Can't open dsspfile "3da6A.bssp"
#ERROR : Can't open dsspfile "2cl1A.bssp"
#ERROR : Can't open dsspfile "3ckxA.bssp"
#ERROR : Can't open dsspfile "3c4eC.bssp"
#ERROR : Can't open dsspfile "1yi6A.bssp"
#ERROR : Can't open dsspfile "2vwiA.bssp"
#ERROR : Can't open dsspfile "2uv2A.bssp"
#ERROR : Can't open dsspfile "1uv5A.bssp"
#ERROR : Can't open dsspfile "2rkuA.bssp"
#ERROR : Can't open dsspfile "1r0eA.bssp"
#ERROR : Can't open dsspfile "1q5kB.bssp"
#ERROR : Can't open dsspfile "1q5kA.bssp"
#ERROR : Can't open dsspfile "1q4lB.bssp"
#ERROR : Can't open dsspfile "1q4lA.bssp"
#ERROR : Can't open dsspfile "1q41B.bssp"
#ERROR : Can't open dsspfile "1q41A.bssp"
#ERROR : Can't open dsspfile "1q3wA.bssp"
#ERROR : Can't open dsspfile "1q3dB.bssp"
#ERROR : Can't open dsspfile "1q3dA.bssp"
#ERROR : Can't open dsspfile "1pyxB.bssp"
#ERROR : Can't open dsspfile "1pyxA.bssp"
#ERROR : Can't open dsspfile "2ou7A.bssp"
#ERROR : Can't open dsspfile "2objA.bssp"
#ERROR : Can't open dsspfile "2o5kA.bssp"
#ERROR : Can't open dsspfile "2jldB.bssp"
#ERROR : Can't open dsspfile "2jldA.bssp"
#ERROR : Can't open dsspfile "2j51A.bssp"
#ERROR : Can't open dsspfile "2j2iB.bssp"
#ERROR : Can't open dsspfile "1j1bB.bssp"
#ERROR : Can't open dsspfile "1j1bA.bssp"
#ERROR : Can't open dsspfile "1i09B.bssp"
#ERROR : Can't open dsspfile "1i09A.bssp"
#ERROR : Can't open dsspfile "1h8fB.bssp"
#ERROR : Can't open dsspfile "1h8fA.bssp"
#ERROR : Can't open dsspfile "1gzkA.bssp"
#ERROR : Can't open dsspfile "3g9lX.bssp"
#ERROR : Can't open dsspfile "3fc2A.bssp"
#ERROR : Can't open dsspfile "3f2aA.bssp"
#ERROR : Can't open dsspfile "3eljA.bssp"
#ERROR : Can't open dsspfile "3du8A.bssp"
#ERROR : Can't open dsspfile "3dcvA.bssp"
#ERROR : Can't open dsspfile "3d5uA.bssp"
#ERROR : Can't open dsspfile "3cy3A.bssp"
#ERROR : Can't open dsspfile "3cy2A.bssp"
#ERROR : Can't open dsspfile "3cxwA.bssp"
#ERROR : Can't open dsspfile "2c3iB.bssp"
#ERROR : Can't open dsspfile "2bzkB.bssp"
#ERROR : Can't open dsspfile "2bzhB.bssp"
#ERROR : Can't open dsspfile "2bilB.bssp"
#ERROR : Can't open dsspfile "2bikB.bssp"
#ERROR : Can't open dsspfile "3bgzA.bssp"
#ERROR : Can't open dsspfile "2qr8A.bssp"
#ERROR : Can't open dsspfile "1pmuA.bssp"
#ERROR : Can't open dsspfile "1k9aE.bssp"
#ERROR : Can't open dsspfile "1k9aD.bssp"
#ERROR : Can't open dsspfile "2jbpI.bssp"
#ERROR : Can't open dsspfile "2jbpF.bssp"
#ERROR : Can't open dsspfile "2jbpD.bssp"
#ERROR : Can't open dsspfile "2hakG.bssp"
#ERROR : Can't open dsspfile "2fgiA.bssp"
#ERROR : Can't open dsspfile "2evaA.bssp"
#ERROR : Can't open dsspfile "3db6A.bssp"
#ERROR : Can't open dsspfile "3daeB.bssp"
#ERROR : Can't open dsspfile "3daeA.bssp"
#ERROR : Can't open dsspfile "2cmwA.bssp"
#ERROR : Can't open dsspfile "2w5aA.bssp"
#ERROR : Can't open dsspfile "1ukhA.bssp"
#ERROR : Can't open dsspfile "1qpjA.bssp"
#ERROR : Can't open dsspfile "1qpdA.bssp"
#ERROR : Can't open dsspfile "1qpcA.bssp"
#ERROR : Can't open dsspfile "2oicC.bssp"
#ERROR : Can't open dsspfile "2ofuA.bssp"
#ERROR : Can't open dsspfile "2jflA.bssp"
#ERROR : Can't open dsspfile "3dtcA.bssp"
#ERROR : Can't open dsspfile "3dqwD.bssp"
#ERROR : Can't open dsspfile "3dqwC.bssp"
#ERROR : Can't open dsspfile "3dqwA.bssp"
#ERROR : Can't open dsspfile "3cokA.bssp"
#ERROR : Can't open dsspfile "3cohA.bssp"
#ERROR : Can't open dsspfile "3bymA.bssp"
#ERROR : Can't open dsspfile "1ad5A.bssp"
#ERROR : Can't open dsspfile "1zy4B.bssp"
#ERROR : Can't open dsspfile "2zoqA.bssp"
#ERROR : Can't open dsspfile "1pyeA.bssp"
#ERROR : Can't open dsspfile "2onlD.bssp"
#ERROR : Can't open dsspfile "2onlC.bssp"
#ERROR : Can't open dsspfile "2jbpE.bssp"
#ERROR : Can't open dsspfile "1h4lA.bssp"
#ERROR : Can't open dsspfile "3dakA.bssp"
#ERROR : Can't open dsspfile "1cm8A.bssp"
#ERROR : Can't open dsspfile "2c47C.bssp"
#ERROR : Can't open dsspfile "1zmwB.bssp"
#ERROR : Can't open dsspfile "1zmwA.bssp"
#ERROR : Can't open dsspfile "1yrpA.bssp"
#ERROR : Can't open dsspfile "2w4oA.bssp"
#ERROR : Can't open dsspfile "2pzyD.bssp"
#ERROR : Can't open dsspfile "1k9aA.bssp"
#ERROR : Can't open dsspfile "2jboA.bssp"
#ERROR : Can't open dsspfile "2j90B.bssp"
#ERROR : Can't open dsspfile "3gxjA.bssp"
#ERROR : Can't open dsspfile "3d7uA.bssp"
#ERROR : Can't open dsspfile "3d5wA.bssp"
#ERROR : Can't open dsspfile "3b2wA.bssp"
#ERROR : Can't open dsspfile "2pvfA.bssp"
#ERROR : Can't open dsspfile "2oh4A.bssp"
#ERROR : Can't open dsspfile "2o8yA.bssp"
#ERROR : Can't open dsspfile "1k9aC.bssp"
#ERROR : Can't open dsspfile "3ezrA.bssp"
#ERROR : Can't open dsspfile "3clyA.bssp"
#ERROR : Can't open dsspfile "2c6eB.bssp"
#ERROR : Can't open dsspfile "1zmvB.bssp"
#ERROR : Can't open dsspfile "1zmvA.bssp"
#ERROR : Can't open dsspfile "1zmuB.bssp"
#ERROR : Can't open dsspfile "1zmuA.bssp"
#ERROR : Can't open dsspfile "1xjdA.bssp"
#ERROR : Can't open dsspfile "2w5hA.bssp"
#ERROR : Can't open dsspfile "2pzyC.bssp"
#ERROR : Can't open dsspfile "2pzyA.bssp"
#ERROR : Can't open dsspfile "2ozaB.bssp"
#ERROR : Can't open dsspfile "2jbpB.bssp"
#ERROR : Can't open dsspfile "3g2fB.bssp"
#ERROR : Can't open dsspfile "2cn8A.bssp"
#ERROR : Can't open dsspfile "2c0tB.bssp"
#ERROR : Can't open dsspfile "2c0tA.bssp"
#ERROR : Can't open dsspfile "2c0iA.bssp"
#ERROR : Can't open dsspfile "3bceB.bssp"
#ERROR : Can't open dsspfile "3bceA.bssp"
#ERROR : Can't open dsspfile "1zy5B.bssp"
#ERROR : Can't open dsspfile "1ql6A.bssp"
#ERROR : Can't open dsspfile "3hkoA.bssp"
#ERROR : Can't open dsspfile "2g2iB.bssp"
#ERROR : Can't open dsspfile "2g2iA.bssp"
#ERROR : Can't open dsspfile "2g2hA.bssp"
#ERROR : Can't open dsspfile "2g2fB.bssp"
#ERROR : Can't open dsspfile "2g2fA.bssp"
#ERROR : Can't open dsspfile "2fysB.bssp"
#ERROR : Can't open dsspfile "1fgiA.bssp"
#ERROR : Can't open dsspfile "2f4jA.bssp"
#ERROR : Can't open dsspfile "3eb0C.bssp"
#ERROR : Can't open dsspfile "3eb0A.bssp"
#ERROR : Can't open dsspfile "3dk3B.bssp"
#ERROR : Can't open dsspfile "3dk3A.bssp"
#ERROR : Can't open dsspfile "3dajA.bssp"
#ERROR : Can't open dsspfile "3c4fA.bssp"
#ERROR : Can't open dsspfile "1agwA.bssp"
#ERROR : Can't open dsspfile "2z60A.bssp"
#ERROR : Can't open dsspfile "1wvyA.bssp"
#ERROR : Can't open dsspfile "1wvwA.bssp"
#ERROR : Can't open dsspfile "2vwiB.bssp"
#ERROR : Can't open dsspfile "1unlA.bssp"
#ERROR : Can't open dsspfile "1unhA.bssp"
#ERROR : Can't open dsspfile "1ungB.bssp"
#ERROR : Can't open dsspfile "1ungA.bssp"
#ERROR : Can't open dsspfile "2qohB.bssp"
#ERROR : Can't open dsspfile "2qohA.bssp"
#ERROR : Can't open dsspfile "1opjB.bssp"
#ERROR : Can't open dsspfile "1opjA.bssp"
#ERROR : Can't open dsspfile "2ogvA.bssp"
#ERROR : Can't open dsspfile "1m52B.bssp"
#ERROR : Can't open dsspfile "1m52A.bssp"
#ERROR : Can't open dsspfile "1k9aB.bssp"
#ERROR : Can't open dsspfile "1k2pA.bssp"
#ERROR : Can't open dsspfile "1jktA.bssp"
#ERROR : Can't open dsspfile "1jkkA.bssp"
#ERROR : Can't open dsspfile "1ig1A.bssp"
#ERROR : Can't open dsspfile "1iepA.bssp"
#ERROR : Can't open dsspfile "2i1mA.bssp"
#ERROR : Can't open dsspfile "2hznA.bssp"
#ERROR : Can't open dsspfile "2hziB.bssp"
#ERROR : Can't open dsspfile "2hziA.bssp"
#ERROR : Can't open dsspfile "2hz4C.bssp"
#ERROR : Can't open dsspfile "2hz4B.bssp"
#ERROR : Can't open dsspfile "2hz4A.bssp"
#ERROR : Can't open dsspfile "2hz0A.bssp"
#ERROR : Can't open dsspfile "2hyyD.bssp"
#ERROR : Can't open dsspfile "2hyyB.bssp"
#ERROR : Can't open dsspfile "2hyyA.bssp"
#ERROR : Can't open dsspfile "2hiwA.bssp"
#ERROR : Can't open dsspfile "3gcuA.bssp"
#ERROR : Can't open dsspfile "3g2fA.bssp"
#ERROR : Can't open dsspfile "2g1tD.bssp"
#ERROR : Can't open dsspfile "2g1tC.bssp"
#ERROR : Can't open dsspfile "2g1tB.bssp"
#ERROR : Can't open dsspfile "2g1tA.bssp"
#ERROR : Can't open dsspfile "1fpuA.bssp"
#ERROR : Can't open dsspfile "3ehaA.bssp"
#ERROR : Can't open dsspfile "3eh9A.bssp"
#ERROR : Can't open dsspfile "2dq7X.bssp"
#ERROR : Can't open dsspfile "3dkcA.bssp"
#ERROR : Can't open dsspfile "3dgkA.bssp"
#ERROR : Can't open dsspfile "3dfcB.bssp"
#ERROR : Can't open dsspfile "3dakB.bssp"
#ERROR : Can't open dsspfile "3cs9D.bssp"
#ERROR : Can't open dsspfile "3cs9A.bssp"
#ERROR : Can't open dsspfile "3beaA.bssp"
#ERROR : Can't open dsspfile "1yhsA.bssp"
#ERROR : Can't open dsspfile "1y8gB.bssp"
#ERROR : Can't open dsspfile "1y8gA.bssp"
#ERROR : Can't open dsspfile "1r0pA.bssp"
#ERROR : Can't open dsspfile "1q8yA.bssp"
#ERROR : Can't open dsspfile "1p4oB.bssp"
#ERROR : Can't open dsspfile "1p4oA.bssp"
#ERROR : Can't open dsspfile "1ol6A.bssp"
#ERROR : Can't open dsspfile "2oj9A.bssp"
#ERROR : Can't open dsspfile "1m7nA.bssp"
#ERROR : Can't open dsspfile "1lezA.bssp"
#ERROR : Can't open dsspfile "2jd5A.bssp"
#ERROR : Can't open dsspfile "2j90A.bssp"
#ERROR : Can't open dsspfile "2i0yA.bssp"
#ERROR : Can't open dsspfile "2i0vA.bssp"
#ERROR : Can't open dsspfile "3ggfB.bssp"
#ERROR : Can't open dsspfile "3ggfA.bssp"
#ERROR : Can't open dsspfile "3gcvA.bssp"
#ERROR : Can't open dsspfile "3gcqA.bssp"
#ERROR : Can't open dsspfile "3g5dB.bssp"
#ERROR : Can't open dsspfile "3g5dA.bssp"
#ERROR : Can't open dsspfile "3f3tB.bssp"
#ERROR : Can't open dsspfile "2erkA.bssp"
#ERROR : Can't open dsspfile "3el8B.bssp"
#ERROR : Can't open dsspfile "3el8A.bssp"
#ERROR : Can't open dsspfile "3blhA.bssp"
#ERROR : Can't open dsspfile "3bceC.bssp"
#ERROR : Can't open dsspfile "2b1pA.bssp"
#ERROR : Can't open dsspfile "1agwB.bssp"
#ERROR : Can't open dsspfile "2oiqA.bssp"
#ERROR : Can't open dsspfile "3gc9B.bssp"
#ERROR : Can't open dsspfile "3gc9A.bssp"
#ERROR : Can't open dsspfile "2fysA.bssp"
#ERROR : Can't open dsspfile "3e63A.bssp"
#ERROR : Can't open dsspfile "3e62A.bssp"
#ERROR : Can't open dsspfile "3coiA.bssp"
#ERROR : Can't open dsspfile "2b7aB.bssp"
#ERROR : Can't open dsspfile "2b7aA.bssp"
#ERROR : Can't open dsspfile "2z7lA.bssp"
#ERROR : Can't open dsspfile "2wgjA.bssp"
#ERROR : Can't open dsspfile "2wd1A.bssp"
#ERROR : Can't open dsspfile "1tvoA.bssp"
#ERROR : Can't open dsspfile "2r4bB.bssp"
#ERROR : Can't open dsspfile "2r4bA.bssp"
#ERROR : Can't open dsspfile "2phkA.bssp"
#ERROR : Can't open dsspfile "1phkA.bssp"
#ERROR : Can't open dsspfile "2ojiA.bssp"
#ERROR : Can't open dsspfile "2ojgA.bssp"
#ERROR : Can't open dsspfile "1k9aF.bssp"
#ERROR : Can't open dsspfile "2i6lA.bssp"
#ERROR : Can't open dsspfile "2gphA.bssp"
#ERROR : Can't open dsspfile "1golA.bssp"
#ERROR : Can't open dsspfile "2g15A.bssp"
#ERROR : Can't open dsspfile "3erkA.bssp"
#ERROR : Can't open dsspfile "1erkA.bssp"
#ERROR : Can't open dsspfile "3e7oB.bssp"
#ERROR : Can't open dsspfile "2dylA.bssp"
#ERROR : Can't open dsspfile "3comB.bssp"
#ERROR : Can't open dsspfile "3comA.bssp"
#ERROR : Can't open dsspfile "2puuA.bssp"
#ERROR : Can't open dsspfile "1mrvA.bssp"
#ERROR : Can't open dsspfile "1koaA.bssp"
#ERROR : Can't open dsspfile "2j7tA.bssp"
#ERROR : Can't open dsspfile "3hp5A.bssp"
#ERROR : Can't open dsspfile "3h0zC.bssp"
#ERROR : Can't open dsspfile "3h0zB.bssp"
#ERROR : Can't open dsspfile "3gp0A.bssp"
#ERROR : Can't open dsspfile "3gc8B.bssp"
#ERROR : Can't open dsspfile "3gc8A.bssp"
#ERROR : Can't open dsspfile "3etaA.bssp"
#ERROR : Can't open dsspfile "3dfaA.bssp"
#ERROR : Can't open dsspfile "3d2kA.bssp"
#ERROR : Can't open dsspfile "3ctqA.bssp"
#ERROR : Can't open dsspfile "1bygA.bssp"
#ERROR : Can't open dsspfile "3bhyA.bssp"
#ERROR : Can't open dsspfile "2bakA.bssp"
#ERROR : Can't open dsspfile "2qd9A.bssp"
#ERROR : Can't open dsspfile "1p4fA.bssp"
#ERROR : Can't open dsspfile "1oplB.bssp"
#ERROR : Can't open dsspfile "1oplA.bssp"
#ERROR : Can't open dsspfile "1opkA.bssp"
#ERROR : Can't open dsspfile "2jbpA.bssp"
#ERROR : Can't open dsspfile "3hmiA.bssp"
#ERROR : Can't open dsspfile "2gtmA.bssp"
#ERROR : Can't open dsspfile "3gc0A.bssp"
#ERROR : Can't open dsspfile "3g6hA.bssp"
#ERROR : Can't open dsspfile "2fo0A.bssp"
#ERROR : Can't open dsspfile "3f6xD.bssp"
#ERROR : Can't open dsspfile "3f6xC.bssp"
#ERROR : Can't open dsspfile "3f6xA.bssp"
#ERROR : Can't open dsspfile "2eb2A.bssp"
#ERROR : Can't open dsspfile "3dqxB.bssp"
#ERROR : Can't open dsspfile "3dqxA.bssp"
#ERROR : Can't open dsspfile "2clqA.bssp"
#ERROR : Can't open dsspfile "2bdfB.bssp"
#ERROR : Can't open dsspfile "1zz2A.bssp"
#ERROR : Can't open dsspfile "2zvaA.bssp"
#ERROR : Can't open dsspfile "2zv7A.bssp"
#ERROR : Can't open dsspfile "1ywrA.bssp"
#ERROR : Can't open dsspfile "2v7aB.bssp"
#ERROR : Can't open dsspfile "2v7aA.bssp"
#ERROR : Can't open dsspfile "1t46A.bssp"
#ERROR : Can't open dsspfile "1t45A.bssp"
#ERROR : Can't open dsspfile "2rf9B.bssp"
#ERROR : Can't open dsspfile "2qi8B.bssp"
#ERROR : Can't open dsspfile "2pvyD.bssp"
#ERROR : Can't open dsspfile "2pvyA.bssp"
#ERROR : Can't open dsspfile "1pkgA.bssp"
#ERROR : Can't open dsspfile "2og8B.bssp"
#ERROR : Can't open dsspfile "2ofvA.bssp"
#ERROR : Can't open dsspfile "1lewA.bssp"
#ERROR : Can't open dsspfile "2javA.bssp"
#ERROR : Can't open dsspfile "3hl7A.bssp"
#ERROR : Can't open dsspfile "3gt8C.bssp"
#ERROR : Can't open dsspfile "2gtnA.bssp"
#ERROR : Can't open dsspfile "3gqlA.bssp"
#ERROR : Can't open dsspfile "2gqgB.bssp"
#ERROR : Can't open dsspfile "2gqgA.bssp"
#ERROR : Can't open dsspfile "3gcpA.bssp"
#ERROR : Can't open dsspfile "3g0fB.bssp"
#ERROR : Can't open dsspfile "3g0fA.bssp"
#ERROR : Can't open dsspfile "3g0eA.bssp"
#ERROR : Can't open dsspfile "3fv8A.bssp"
#ERROR : Can't open dsspfile "3fi2A.bssp"
#ERROR : Can't open dsspfile "2e14A.bssp"
#ERROR : Can't open dsspfile "3dpkA.bssp"
#ERROR : Can't open dsspfile "3dk7B.bssp"
#ERROR : Can't open dsspfile "3dk7A.bssp"
#ERROR : Can't open dsspfile "3dk6B.bssp"
#ERROR : Can't open dsspfile "3dk6A.bssp"
#ERROR : Can't open dsspfile "3cokB.bssp"
#ERROR : Can't open dsspfile "3c9wA.bssp"
#ERROR : Can't open dsspfile "3bv3A.bssp"
#ERROR : Can't open dsspfile "2bdjA.bssp"
#ERROR : Can't open dsspfile "2bdfA.bssp"
#ERROR : Can't open dsspfile "2bajA.bssp"
#ERROR : Can't open dsspfile "1ua2A.bssp"
#ERROR : Can't open dsspfile "2rg6A.bssp"
#ERROR : Can't open dsspfile "2r2pA.bssp"
#ERROR : Can't open dsspfile "2qlqB.bssp"
#ERROR : Can't open dsspfile "2q0bB.bssp"
#ERROR : Can't open dsspfile "2q0bA.bssp"
#ERROR : Can't open dsspfile "2pzpB.bssp"
#ERROR : Can't open dsspfile "2pzpA.bssp"
#ERROR : Can't open dsspfile "2pz5B.bssp"
#ERROR : Can't open dsspfile "2pz5A.bssp"
#ERROR : Can't open dsspfile "2py3B.bssp"
#ERROR : Can't open dsspfile "2py3A.bssp"
#ERROR : Can't open dsspfile "2pwlB.bssp"
#ERROR : Can't open dsspfile "2pwlA.bssp"
#ERROR : Can't open dsspfile "2psqB.bssp"
#ERROR : Can't open dsspfile "2psqA.bssp"
#ERROR : Can't open dsspfile "2okrA.bssp"
#ERROR : Can't open dsspfile "1m17A.bssp"
#ERROR : Can't open dsspfile "1m14A.bssp"
#ERROR : Can't open dsspfile "2jiuB.bssp"
#ERROR : Can't open dsspfile "2jiuA.bssp"
#ERROR : Can't open dsspfile "2jitB.bssp"
#ERROR : Can't open dsspfile "2jitA.bssp"
#ERROR : Can't open dsspfile "2j6mA.bssp"
#ERROR : Can't open dsspfile "2j5eA.bssp"
#ERROR : Can't open dsspfile "2itwA.bssp"
#ERROR : Can't open dsspfile "2itqA.bssp"
#ERROR : Can't open dsspfile "2itpA.bssp"
#ERROR : Can't open dsspfile "2hw7A.bssp"
#ERROR : Can't open dsspfile "2hakH.bssp"
#ERROR : Can't open dsspfile "2hakB.bssp"
#ERROR : Can't open dsspfile "2gs6A.bssp"
#ERROR : Can't open dsspfile "2gs2A.bssp"
#ERROR : Can't open dsspfile "1gjoA.bssp"
#ERROR : Can't open dsspfile "2ghlA.bssp"
#ERROR : Can't open dsspfile "3geqB.bssp"
#ERROR : Can't open dsspfile "1fmkA.bssp"
#ERROR : Can't open dsspfile "3f6xB.bssp"
#ERROR : Can't open dsspfile "3eyhA.bssp"
#ERROR : Can't open dsspfile "3eygA.bssp"
#ERROR : Can't open dsspfile "3etaB.bssp"
#ERROR : Can't open dsspfile "3d7tB.bssp"
#ERROR : Can't open dsspfile "3cd8A.bssp"
#ERROR : Can't open dsspfile "3ccnA.bssp"
#ERROR : Can't open dsspfile "3bv2A.bssp"
#ERROR : Can't open dsspfile "3bbwA.bssp"
#ERROR : Can't open dsspfile "3bbwB.bssp"
#ERROR : Can't open dsspfile "3bbtB.bssp"
#ERROR : Can't open dsspfile "3b2tB.bssp"
#ERROR : Can't open dsspfile "3b2tA.bssp"
#ERROR : Can't open dsspfile "2zm3D.bssp"
#ERROR : Can't open dsspfile "2zm3C.bssp"
#ERROR : Can't open dsspfile "2zm3B.bssp"
#ERROR : Can't open dsspfile "2zm3A.bssp"
#ERROR : Can't open dsspfile "2qq7A.bssp"
#ERROR : Can't open dsspfile "2qi8A.bssp"
#ERROR : Can't open dsspfile "1q8zA.bssp"
#ERROR : Can't open dsspfile "2okrD.bssp"
#ERROR : Can't open dsspfile "2oiqB.bssp"
#ERROR : Can't open dsspfile "1k3aA.bssp"
#ERROR : Can't open dsspfile "1jqhB.bssp"
#ERROR : Can't open dsspfile "1jqhA.bssp"
#ERROR : Can't open dsspfile "2izuA.bssp"
#ERROR : Can't open dsspfile "2iztA.bssp"
#ERROR : Can't open dsspfile "2izrA.bssp"
#ERROR : Can't open dsspfile "2hyyC.bssp"
#ERROR : Can't open dsspfile "3gc7A.bssp"
#ERROR : Can't open dsspfile "3f5pS.bssp"
#ERROR : Can't open dsspfile "3f5pM.bssp"
#ERROR : Can't open dsspfile "3f5pI.bssp"
#ERROR : Can't open dsspfile "3f5pE.bssp"
#ERROR : Can't open dsspfile "3f5pD.bssp"
#ERROR : Can't open dsspfile "3f5pC.bssp"
#ERROR : Can't open dsspfile "3f5pB.bssp"
#ERROR : Can't open dsspfile "3f5pA.bssp"
#ERROR : Can't open dsspfile "3e3pB.bssp"
#ERROR : Can't open dsspfile "3e3pA.bssp"
#ERROR : Can't open dsspfile "3ds6A.bssp"
#ERROR : Can't open dsspfile "2chlA.bssp"
#ERROR : Can't open dsspfile "3bbtD.bssp"
#ERROR : Can't open dsspfile "2ac5A.bssp"
#ERROR : Can't open dsspfile "1zyjA.bssp"
#ERROR : Can't open dsspfile "2zv9A.bssp"
#ERROR : Can't open dsspfile "1rjbA.bssp"
#ERROR : Can't open dsspfile "2p2iA.bssp"
#ERROR : Can't open dsspfile "2ofvB.bssp"
#ERROR : Can't open dsspfile "3gqlC.bssp"
#ERROR : Can't open dsspfile "3gqlB.bssp"
#ERROR : Can't open dsspfile "3fy2A.bssp"
#ERROR : Can't open dsspfile "1fpuB.bssp"
#ERROR : Can't open dsspfile "3fi3A.bssp"
#ERROR : Can't open dsspfile "3en4B.bssp"
#ERROR : Can't open dsspfile "2e2bB.bssp"
#ERROR : Can't open dsspfile "2e2bA.bssp"
#ERROR : Can't open dsspfile "2clqB.bssp"
#ERROR : Can't open dsspfile "2bujB.bssp"
#ERROR : Can't open dsspfile "2zb1A.bssp"
#ERROR : Can't open dsspfile "2rfsA.bssp"
#ERROR : Can't open dsspfile "2rfeD.bssp"
#ERROR : Can't open dsspfile "2rfeC.bssp"
#ERROR : Can't open dsspfile "2rfeB.bssp"
#ERROR : Can't open dsspfile "2rfdA.bssp"
#ERROR : Can't open dsspfile "2r9sA.bssp"
#ERROR : Can't open dsspfile "1r1wA.bssp"
#ERROR : Can't open dsspfile "2qu5A.bssp"
#ERROR : Can't open dsspfile "2pzrB.bssp"
#ERROR : Can't open dsspfile "2pzrA.bssp"
#ERROR : Can't open dsspfile "2pvyC.bssp"
#ERROR : Can't open dsspfile "2ityA.bssp"
#ERROR : Can't open dsspfile "2itoA.bssp"
#ERROR : Can't open dsspfile "2itnA.bssp"
#ERROR : Can't open dsspfile "3hp2A.bssp"
#ERROR : Can't open dsspfile "3hllA.bssp"
#ERROR : Can't open dsspfile "2ghmA.bssp"
#ERROR : Can't open dsspfile "3f66A.bssp"
#ERROR : Can't open dsspfile "3c5uA.bssp"
#ERROR : Can't open dsspfile "2ac3A.bssp"
#ERROR : Can't open dsspfile "2zb0A.bssp"
#ERROR : Can't open dsspfile "2zazA.bssp"
#ERROR : Can't open dsspfile "1yqjA.bssp"
#ERROR : Can't open dsspfile "1wbsA.bssp"
#ERROR : Can't open dsspfile "1u59A.bssp"
#ERROR : Can't open dsspfile "2rg5A.bssp"
#ERROR : Can't open dsspfile "2rf9A.bssp"
#ERROR : Can't open dsspfile "2qq7B.bssp"
#ERROR : Can't open dsspfile "2ptkA.bssp"
#ERROR : Can't open dsspfile "1oz1A.bssp"
#ERROR : Can't open dsspfile "1ouyA.bssp"
#ERROR : Can't open dsspfile "2onlA.bssp"
#ERROR : Can't open dsspfile "2og8A.bssp"
#ERROR : Can't open dsspfile "2jbpL.bssp"
#ERROR : Can't open dsspfile "3hrbA.bssp"
#ERROR : Can't open dsspfile "3gfeA.bssp"
#ERROR : Can't open dsspfile "3geqA.bssp"
#ERROR : Can't open dsspfile "3g6hB.bssp"
#ERROR : Can't open dsspfile "3fqeA.bssp"
#ERROR : Can't open dsspfile "3f3wB.bssp"
#ERROR : Can't open dsspfile "3f3wA.bssp"
#ERROR : Can't open dsspfile "3f3vB.bssp"
#ERROR : Can't open dsspfile "3f3uB.bssp"
#ERROR : Can't open dsspfile "3f3tA.bssp"
#ERROR : Can't open dsspfile "3ewhA.bssp"
#ERROR : Can't open dsspfile "3en5B.bssp"
#ERROR : Can't open dsspfile "1di9A.bssp"
#ERROR : Can't open dsspfile "3d7zA.bssp"
#ERROR : Can't open dsspfile "3byuA.bssp"
#ERROR : Can't open dsspfile "3bysA.bssp"
#ERROR : Can't open dsspfile "2bujA.bssp"
#ERROR : Can't open dsspfile "1bmkA.bssp"
#ERROR : Can't open dsspfile "1yw2A.bssp"
#ERROR : Can't open dsspfile "1yvjA.bssp"
#ERROR : Can't open dsspfile "1xkkA.bssp"
#ERROR : Can't open dsspfile "1xbcA.bssp"
#ERROR : Can't open dsspfile "1xbaA.bssp"
#ERROR : Can't open dsspfile "2rgpA.bssp"
#ERROR : Can't open dsspfile "1pmeA.bssp"
#ERROR : Can't open dsspfile "1kv1A.bssp"
#ERROR : Can't open dsspfile "2j5fA.bssp"
#ERROR : Can't open dsspfile "2gs7B.bssp"
#ERROR : Can't open dsspfile "3fqhA.bssp"
#ERROR : Can't open dsspfile "3dbeA.bssp"
#ERROR : Can't open dsspfile "3d7tA.bssp"
#ERROR : Can't open dsspfile "3belA.bssp"
#ERROR : Can't open dsspfile "1zxeD.bssp"
#ERROR : Can't open dsspfile "2vwxA.bssp"
#ERROR : Can't open dsspfile "2rfeA.bssp"
#ERROR : Can't open dsspfile "2rfdB.bssp"
#ERROR : Can't open dsspfile "2pkjA.bssp"
#ERROR : Can't open dsspfile "2p2hA.bssp"
#ERROR : Can't open dsspfile "2jivB.bssp"
#ERROR : Can't open dsspfile "2itxA.bssp"
#ERROR : Can't open dsspfile "1howA.bssp"
#ERROR : Can't open dsspfile "3ha8A.bssp"
#ERROR : Can't open dsspfile "3gvuA.bssp"
#ERROR : Can't open dsspfile "3f66B.bssp"
#ERROR : Can't open dsspfile "3en4A.bssp"
#ERROR : Can't open dsspfile "3bx5A.bssp"
#ERROR : Can't open dsspfile "1xbbA.bssp"
#ERROR : Can't open dsspfile "2vx0A.bssp"
#ERROR : Can't open dsspfile "2qokA.bssp"
#ERROR : Can't open dsspfile "2ptjA.bssp"
#ERROR : Can't open dsspfile "3k2lA.bssp"
#ERROR : Can't open dsspfile "2j0lA.bssp"
#ERROR : Can't open dsspfile "1irkA.bssp"
#ERROR : Can't open dsspfile "2i6lB.bssp"
#ERROR : Can't open dsspfile "2hwoA.bssp"
#ERROR : Can't open dsspfile "2gs7A.bssp"
#ERROR : Can't open dsspfile "3gcsA.bssp"
#ERROR : Can't open dsspfile "3g6gB.bssp"
#ERROR : Can't open dsspfile "3g6gA.bssp"
#ERROR : Can't open dsspfile "3fxxA.bssp"
#ERROR : Can't open dsspfile "3fqhB.bssp"
#ERROR : Can't open dsspfile "3emgA.bssp"
#ERROR : Can't open dsspfile "3el7A.bssp"
#ERROR : Can't open dsspfile "3dtwB.bssp"
#ERROR : Can't open dsspfile "2baqA.bssp"
#ERROR : Can't open dsspfile "2wqeA.bssp"
#ERROR : Can't open dsspfile "2wntB.bssp"
#ERROR : Can't open dsspfile "2wntA.bssp"
#ERROR : Can't open dsspfile "2rl5A.bssp"
#ERROR : Can't open dsspfile "1r39A.bssp"
#ERROR : Can't open dsspfile "2qocA.bssp"
#ERROR : Can't open dsspfile "2pvyB.bssp"
#ERROR : Can't open dsspfile "2jivA.bssp"
#ERROR : Can't open dsspfile "2ivvA.bssp"
#ERROR : Can't open dsspfile "2itzA.bssp"
#ERROR : Can't open dsspfile "2itvA.bssp"
#ERROR : Can't open dsspfile "2ituA.bssp"
#ERROR : Can't open dsspfile "2ittA.bssp"
#ERROR : Can't open dsspfile "3gt8D.bssp"
#ERROR : Can't open dsspfile "3gt8B.bssp"
#ERROR : Can't open dsspfile "3gt8A.bssp"
#ERROR : Can't open dsspfile "3efwA.bssp"
#ERROR : Can't open dsspfile "3dkfA.bssp"
#ERROR : Can't open dsspfile "3d94A.bssp"
#ERROR : Can't open dsspfile "2balA.bssp"
#ERROR : Can't open dsspfile "1zxeC.bssp"
#ERROR : Can't open dsspfile "2ozoA.bssp"
#ERROR : Can't open dsspfile "1kwpA.bssp"
#ERROR : Can't open dsspfile "2hz0B.bssp"
#ERROR : Can't open dsspfile "3hngA.bssp"
#ERROR : Can't open dsspfile "3gopA.bssp"
#ERROR : Can't open dsspfile "2ewaA.bssp"
#ERROR : Can't open dsspfile "3efwB.bssp"
#ERROR : Can't open dsspfile "3eflB.bssp"
#ERROR : Can't open dsspfile "2eb3A.bssp"
#ERROR : Can't open dsspfile "3dlsF.bssp"
#ERROR : Can't open dsspfile "3dlsE.bssp"
#ERROR : Can't open dsspfile "3dlsD.bssp"
#ERROR : Can't open dsspfile "3dlsC.bssp"
#ERROR : Can't open dsspfile "3dlsB.bssp"
#ERROR : Can't open dsspfile "3dlsA.bssp"
#ERROR : Can't open dsspfile "3dkgA.bssp"
#ERROR : Can't open dsspfile "3cthA.bssp"
#ERROR : Can't open dsspfile "3cpcB.bssp"
#ERROR : Can't open dsspfile "3cpbB.bssp"
#ERROR : Can't open dsspfile "3cp9B.bssp"
#ERROR : Can't open dsspfile "3cp9A.bssp"
#ERROR : Can't open dsspfile "3ce3A.bssp"
#ERROR : Can't open dsspfile "3b8rB.bssp"
#ERROR : Can't open dsspfile "3b8rA.bssp"
#ERROR : Can't open dsspfile "3b8qB.bssp"
#ERROR : Can't open dsspfile "2qonA.bssp"
#ERROR : Can't open dsspfile "1q97B.bssp"
#ERROR : Can't open dsspfile "1q8zB.bssp"
#ERROR : Can't open dsspfile "1q8yB.bssp"
#ERROR : Can't open dsspfile "2p5aA.bssp"
#ERROR : Can't open dsspfile "2jd5B.bssp"
#ERROR : Can't open dsspfile "2ivuA.bssp"
#ERROR : Can't open dsspfile "2ivtA.bssp"
#ERROR : Can't open dsspfile "2ivsA.bssp"
#ERROR : Can't open dsspfile "1csnA.bssp"
#ERROR : Can't open dsspfile "2b9iA.bssp"
#ERROR : Can't open dsspfile "2qobA.bssp"
#ERROR : Can't open dsspfile "2qo9A.bssp"
#ERROR : Can't open dsspfile "2gsfA.bssp"
#ERROR : Can't open dsspfile "3dzqA.bssp"
#ERROR : Can't open dsspfile "3cg2A.bssp"
#ERROR : Can't open dsspfile "1yomA.bssp"
#ERROR : Can't open dsspfile "1yojB.bssp"
#ERROR : Can't open dsspfile "2reiA.bssp"
#ERROR : Can't open dsspfile "2qu6A.bssp"
#ERROR : Can't open dsspfile "2pv8A.bssp"
#ERROR : Can't open dsspfile "1pkgB.bssp"
#ERROR : Can't open dsspfile "3eknA.bssp"
#ERROR : Can't open dsspfile "3eflA.bssp"
#ERROR : Can't open dsspfile "3e92A.bssp"
#ERROR : Can't open dsspfile "3cs9C.bssp"
#ERROR : Can't open dsspfile "3cs9B.bssp"
#ERROR : Can't open dsspfile "3blrA.bssp"
#ERROR : Can't open dsspfile "3blqA.bssp"
#ERROR : Can't open dsspfile "3be2A.bssp"
#ERROR : Can't open dsspfile "2ptoA.bssp"
#ERROR : Can't open dsspfile "2hw6B.bssp"
#ERROR : Can't open dsspfile "3gniB.bssp"
#ERROR : Can't open dsspfile "3d83A.bssp"
#ERROR : Can't open dsspfile "3d5xA.bssp"
#ERROR : Can't open dsspfile "2z8cA.bssp"
#ERROR : Can't open dsspfile "1yomB.bssp"
#ERROR : Can't open dsspfile "2qlqA.bssp"
#ERROR : Can't open dsspfile "2pmlX.bssp"
#ERROR : Can't open dsspfile "2npqA.bssp"
#ERROR : Can't open dsspfile "1mqbA.bssp"
#ERROR : Can't open dsspfile "1ir3A.bssp"
#ERROR : Can't open dsspfile "2hwoB.bssp"
#ERROR : Can't open dsspfile "2fsmX.bssp"
#ERROR : Can't open dsspfile "3fc1X.bssp"
#ERROR : Can't open dsspfile "3en7B.bssp"
#ERROR : Can't open dsspfile "3en7A.bssp"
#ERROR : Can't open dsspfile "3en6B.bssp"
#ERROR : Can't open dsspfile "3d7uD.bssp"
#ERROR : Can't open dsspfile "3d7uB.bssp"
#ERROR : Can't open dsspfile "3bu5A.bssp"
#ERROR : Can't open dsspfile "3bu3A.bssp"
#ERROR : Can't open dsspfile "2auhA.bssp"
#ERROR : Can't open dsspfile "2wo6B.bssp"
#ERROR : Can't open dsspfile "2wo6A.bssp"
#ERROR : Can't open dsspfile "2vx3D.bssp"
#ERROR : Can't open dsspfile "2vx3C.bssp"
#ERROR : Can't open dsspfile "2vx3B.bssp"
#ERROR : Can't open dsspfile "2vx3A.bssp"
#ERROR : Can't open dsspfile "2qo7A.bssp"
#ERROR : Can't open dsspfile "2qo2A.bssp"
#ERROR : Can't open dsspfile "1kwpB.bssp"
#ERROR : Can't open dsspfile "3fmeA.bssp"
#ERROR : Can't open dsspfile "3dkoA.bssp"
#ERROR : Can't open dsspfile "2ijmB.bssp"
#ERROR : Can't open dsspfile "2hwpA.bssp"
#ERROR : Can't open dsspfile "3cjgA.bssp"
#ERROR : Can't open dsspfile "3cd3A.bssp"
#ERROR : Can't open dsspfile "3brbA.bssp"
#ERROR : Can't open dsspfile "1zxeA.bssp"
#ERROR : Can't open dsspfile "1vr2A.bssp"
#ERROR : Can't open dsspfile "2qoqA.bssp"
#ERROR : Can't open dsspfile "1nxkD.bssp"
#ERROR : Can't open dsspfile "1mqbB.bssp"
#ERROR : Can't open dsspfile "1kv2A.bssp"
#ERROR : Can't open dsspfile "2ijmA.bssp"
#ERROR : Can't open dsspfile "3fbvI.bssp"
#ERROR : Can't open dsspfile "3fbvD.bssp"
#ERROR : Can't open dsspfile "3fbvA.bssp"
#ERROR : Can't open dsspfile "3f82A.bssp"
#ERROR : Can't open dsspfile "3e93A.bssp"
#ERROR : Can't open dsspfile "3ckwA.bssp"
#ERROR : Can't open dsspfile "3bprD.bssp"
#ERROR : Can't open dsspfile "3bprC.bssp"
#ERROR : Can't open dsspfile "3bprB.bssp"
#ERROR : Can't open dsspfile "3bprA.bssp"
#ERROR : Can't open dsspfile "2b9fA.bssp"
#ERROR : Can't open dsspfile "1a06A.bssp"
#ERROR : Can't open dsspfile "1wfcA.bssp"
#ERROR : Can't open dsspfile "1u4dA.bssp"
#ERROR : Can't open dsspfile "2p3gX.bssp"
#ERROR : Can't open dsspfile "2jkqA.bssp"
#ERROR : Can't open dsspfile "2gfsA.bssp"
#ERROR : Can't open dsspfile "3bz3A.bssp"
#ERROR : Can't open dsspfile "1yolB.bssp"
#ERROR : Can't open dsspfile "1yolA.bssp"
#ERROR : Can't open dsspfile "1y6bA.bssp"
#ERROR : Can't open dsspfile "1y6aA.bssp"
#ERROR : Can't open dsspfile "2p2iB.bssp"
#ERROR : Can't open dsspfile "1nxkC.bssp"
#ERROR : Can't open dsspfile "1nxkA.bssp"
#ERROR : Can't open dsspfile "2j0jA.bssp"
#ERROR : Can't open dsspfile "1i44A.bssp"
#ERROR : Can't open dsspfile "1ckjB.bssp"
#ERROR : Can't open dsspfile "1ckjA.bssp"
#ERROR : Can't open dsspfile "3c7qA.bssp"
#ERROR : Can't open dsspfile "1ywnA.bssp"
#ERROR : Can't open dsspfile "2p0cB.bssp"
#ERROR : Can't open dsspfile "2p0cA.bssp"
#ERROR : Can't open dsspfile "1nxkB.bssp"
#ERROR : Can't open dsspfile "1lufA.bssp"
#ERROR : Can't open dsspfile "2jbpK.bssp"
#ERROR : Can't open dsspfile "2f9gA.bssp"
#ERROR : Can't open dsspfile "2etmB.bssp"
#ERROR : Can't open dsspfile "2etmA.bssp"
#ERROR : Can't open dsspfile "1ckiB.bssp"
#ERROR : Can't open dsspfile "1ckiA.bssp"
#ERROR : Can't open dsspfile "3cblA.bssp"
#ERROR : Can't open dsspfile "3brbB.bssp"
#ERROR : Can't open dsspfile "3bkbA.bssp"
#ERROR : Can't open dsspfile "2qooA.bssp"
#ERROR : Can't open dsspfile "2pziA.bssp"
#ERROR : Can't open dsspfile "2fstX.bssp"
#ERROR : Can't open dsspfile "2fsoX.bssp"
#ERROR : Can't open dsspfile "2fslX.bssp"
#ERROR : Can't open dsspfile "2fa2B.bssp"
#ERROR : Can't open dsspfile "2fa2A.bssp"
#ERROR : Can't open dsspfile "2f49A.bssp"
#ERROR : Can't open dsspfile "2b9hA.bssp"
#ERROR : Can't open dsspfile "2a1aB.bssp"
#ERROR : Can't open dsspfile "2a19B.bssp"
#ERROR : Can't open dsspfile "2qu6B.bssp"
#ERROR : Can't open dsspfile "2qolA.bssp"
#ERROR : Can't open dsspfile "2qoiA.bssp"
#ERROR : Can't open dsspfile "2qofA.bssp"
#ERROR : Can't open dsspfile "2qodA.bssp"
#ERROR : Can't open dsspfile "2jkmA.bssp"
#ERROR : Can't open dsspfile "2jbpJ.bssp"
#ERROR : Can't open dsspfile "2j0mB.bssp"
#ERROR : Can't open dsspfile "2j0kA.bssp"
#ERROR : Can't open dsspfile "2hw6A.bssp"
#ERROR : Can't open dsspfile "3dtwA.bssp"
#ERROR : Can't open dsspfile "3cpcA.bssp"
#ERROR : Can't open dsspfile "3cpbA.bssp"
#ERROR : Can't open dsspfile "3b8qA.bssp"
#ERROR : Can't open dsspfile "1zxeF.bssp"
#ERROR : Can't open dsspfile "2vwvA.bssp"
#ERROR : Can't open dsspfile "1u54A.bssp"
#ERROR : Can't open dsspfile "2p4iA.bssp"
#ERROR : Can't open dsspfile "3efkB.bssp"
#ERROR : Can't open dsspfile "3efjA.bssp"
#ERROR : Can't open dsspfile "1u46A.bssp"
#ERROR : Can't open dsspfile "2rioB.bssp"
#ERROR : Can't open dsspfile "2rioA.bssp"
#ERROR : Can't open dsspfile "2pziB.bssp"
#ERROR : Can't open dsspfile "2pv5A.bssp"
#ERROR : Can't open dsspfile "2jkoA.bssp"
#ERROR : Can't open dsspfile "2jkkA.bssp"
#ERROR : Can't open dsspfile "2jc6C.bssp"
#ERROR : Can't open dsspfile "2jc6A.bssp"
#ERROR : Can't open dsspfile "2j0kB.bssp"
#ERROR : Can't open dsspfile "2ivsB.bssp"
#ERROR : Can't open dsspfile "1sm2A.bssp"
#ERROR : Can't open dsspfile "3h9rA.bssp"
#ERROR : Can't open dsspfile "3ctjA.bssp"
#ERROR : Can't open dsspfile "3c1xA.bssp"
#ERROR : Can't open dsspfile "1yojA.bssp"
#ERROR : Can't open dsspfile "2helA.bssp"
#ERROR : Can't open dsspfile "3db8A.bssp"
#ERROR : Can't open dsspfile "1u5qA.bssp"
#ERROR : Can't open dsspfile "3d5vA.bssp"
#ERROR : Can't open dsspfile "1zxeE.bssp"
#ERROR : Can't open dsspfile "1zxeB.bssp"
#ERROR : Can't open dsspfile "1t4hA.bssp"
#ERROR : Can't open dsspfile "1jpaB.bssp"
#ERROR : Can't open dsspfile "1jpaA.bssp"
#ERROR : Can't open dsspfile "2hwpB.bssp"
#ERROR : Can't open dsspfile "3fpqB.bssp"
#ERROR : Can't open dsspfile "3fpqA.bssp"
#ERROR : Can't open dsspfile "3eqrB.bssp"
#ERROR : Can't open dsspfile "3en6A.bssp"
#ERROR : Can't open dsspfile "3en5A.bssp"
#ERROR : Can't open dsspfile "1u54B.bssp"
#ERROR : Can't open dsspfile "1u4dB.bssp"
#ERROR : Can't open dsspfile "1u46B.bssp"
#ERROR : Can't open dsspfile "1p14A.bssp"
#ERROR : Can't open dsspfile "2henA.bssp"
#ERROR : Can't open dsspfile "1fvrB.bssp"
#ERROR : Can't open dsspfile "1fvrA.bssp"
#ERROR : Can't open dsspfile "3eqrA.bssp"
#ERROR : Can't open dsspfile "3eqpA.bssp"
#ERROR : Can't open dsspfile "3eqpB.bssp"
#ERROR : Can't open dsspfile "2vwwA.bssp"
#ERROR : Can't open dsspfile "1tkiA.bssp"
#ERROR : Can't open dsspfile "2rfnB.bssp"
#ERROR : Can't open dsspfile "2rfnA.bssp"
#ERROR : Can't open dsspfile "2p4iB.bssp"
#ERROR : Can't open dsspfile "2oscA.bssp"
#ERROR : Can't open dsspfile "2oo8X.bssp"
#ERROR : Can't open dsspfile "3efjB.bssp"
#ERROR : Can't open dsspfile "3cc6A.bssp"
#ERROR : Can't open dsspfile "1sm2B.bssp"
#ERROR : Can't open dsspfile "3enmB.bssp"
#ERROR : Can't open dsspfile "3fzoA.bssp"
#ERROR : Can't open dsspfile "3et7A.bssp"
#ERROR : Can't open dsspfile "3enmC.bssp"
#ERROR : Can't open dsspfile "3ekkA.bssp"
#ERROR : Can't open dsspfile "1z57A.bssp"
#ERROR : Can't open dsspfile "1kobA.bssp"
#ERROR : Can't open dsspfile "3h3cA.bssp"
#ERROR : Can't open dsspfile "3fzsA.bssp"
#ERROR : Can't open dsspfile "2exeA.bssp"
#ERROR : Can't open dsspfile "3e3bX.bssp"
#ERROR : Can't open dsspfile "3fzpA.bssp"
#ERROR : Can't open dsspfile "3bw5A.bssp"
#ERROR : Can't open dsspfile "1zohA.bssp"
#ERROR : Can't open dsspfile "2qc6A.bssp"
#ERROR : Can't open dsspfile "2pvkA.bssp"
#ERROR : Can't open dsspfile "2pvjA.bssp"
#ERROR : Can't open dsspfile "1om1A.bssp"
#ERROR : Can't open dsspfile "1mp8A.bssp"
#ERROR : Can't open dsspfile "1lp4A.bssp"
#ERROR : Can't open dsspfile "3fztA.bssp"
#ERROR : Can't open dsspfile "3fl5A.bssp"
#ERROR : Can't open dsspfile "1f0qA.bssp"
#ERROR : Can't open dsspfile "1ds5A.bssp"
#ERROR : Can't open dsspfile "2zjwA.bssp"
#ERROR : Can't open dsspfile "2rkpA.bssp"
#ERROR : Can't open dsspfile "2r7iD.bssp"
#ERROR : Can't open dsspfile "2r7iC.bssp"
#ERROR : Can't open dsspfile "2r7iB.bssp"
#ERROR : Can't open dsspfile "2r7iA.bssp"
#ERROR : Can't open dsspfile "2pvrA.bssp"
#ERROR : Can't open dsspfile "1pjkA.bssp"
#ERROR : Can't open dsspfile "1na7A.bssp"
#ERROR : Can't open dsspfile "1jwhB.bssp"
#ERROR : Can't open dsspfile "1jwhA.bssp"
#ERROR : Can't open dsspfile "3h30A.bssp"
#ERROR : Can't open dsspfile "3bqcA.bssp"
#ERROR : Can't open dsspfile "2eu9A.bssp"
#ERROR : Can't open dsspfile "3cjfA.bssp"
#ERROR : Can't open dsspfile "2vagA.bssp"
#ERROR : Can't open dsspfile "2qr7A.bssp"
#ERROR : Can't open dsspfile "3enmD.bssp"
#ERROR : Can't open dsspfile "3enmA.bssp"
#ERROR : Can't open dsspfile "2jiiB.bssp"
#ERROR : Can't open dsspfile "2jiiA.bssp"
#ERROR : Can't open dsspfile "2a19C.bssp"
#ERROR : Can't open dsspfile "1t53A.bssp"

## Summary of PDB Search
:543
    1e-26  40%  3f69B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    2e-25  42%  2fumA  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    1e-24  42%  2fumB  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    4e-24  42%  1o6yA  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE
    6e-24  42%  3f69A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    1e-23  41%  2fumD  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    1e-23  41%  1mruB  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    1e-23  41%  1mruA  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    4e-22  41%  3f61A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    6e-21  40%  2fumC  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    4e-17  40%  2biyA  [x.x.x] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    2e-16  38%  3hrfA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    8e-16  37%  2r3qA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-16  37%  2r3iA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-16  37%  1gz8A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-15  36%  1uwhA  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    1e-15  36%  3d4qA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    2e-15  32%  1vzoA  [d.144.1] RIBOSOMAL PROTEIN S6 KINASE ALPHA 5
    2e-15  37%  3idpA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    2e-15  35%  2h9vA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    2e-15  37%  2fb8A  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    2e-15  35%  2f2uB  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    2e-15  35%  2f2uA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    2e-15  32%  2c30A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 6
    3e-15  36%  1uwjA  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    3e-15  40%  1uu7A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    4e-15  38%  1ykrA  [d.144.1 (1finA)] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2wipC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2wipA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1vywC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1vywA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2vtrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  37%  1uwjB  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    4e-15  38%  2r3hA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  39%  2qnjB  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    4e-15  38%  1okvC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1okvA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1oirA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1jsvA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1hckA  [d.144.1 (1pw2A)] HUMAN CYCLIN-DEPENDENT KINASE 2
    4e-15  38%  1h0uA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1h01A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  3f5xA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1f5qC  [d.144.1] CYCLIN DEPENDENT KINASE 2
    4e-15  38%  1f5qA  [d.144.1] CYCLIN DEPENDENT KINASE 2
    4e-15  38%  3eocC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  3ej1C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  3ej1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1e1vA  [d.144.1] CYCLIN-DEPENDENT PROTEIN KINASE 2
    4e-15  38%  2ds1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2clxA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2c6iA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2c68A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2c5yA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2c4gC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2c4gA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  1buhA  [d.144.1] PROTEIN (CDK2 HUMAN)
    4e-15  38%  2bkzC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-15  38%  2a4lA  [x.x.x] HOMO SAPIENS CYCLIN-DEPENDENT KINASE 2
    5e-15  38%  1zrzA  [x.x.x] PROTEIN KINASE C, IOTA
    5e-15  40%  1okyA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
    5e-15  39%  3hrcA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    5e-15  42%  3h9oA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    5e-15  39%  1h1wA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    6e-15  41%  1uu8A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    6e-15  40%  2qnjA  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    6e-15  38%  3h4jA  [x.x.x] SNF1-LIKE PROTEIN KINASE SSP2
    6e-15  38%  3h4jB  [x.x.x] SNF1-LIKE PROTEIN KINASE SSP2
    6e-15  32%  1fotA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE TYPE 1
    8e-15  34%  2v55C  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    8e-15  34%  2v55A  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    8e-15  37%  3idpB  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    8e-15  34%  2etkB  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    8e-15  34%  2etkA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    1e-14  41%  1uu9A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    1e-14  41%  1okzA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
    1e-14  38%  2hakE  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    1e-14  40%  3eidC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-14  34%  3c51B  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c51A  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c50B  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c50A  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c4zA  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c4yB  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c4yA  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c4xB  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c4xA  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c4wB  [x.x.x] RHODOPSIN KINASE
    1e-14  34%  3c4wA  [x.x.x] RHODOPSIN KINASE
    2e-14  40%  2z7sA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    2e-14  40%  2z7rA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    2e-14  40%  2z7qA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    2e-14  42%  1z5mA  [x.x.x] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    2e-14  42%  1uu3A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    2e-14  42%  2r7bA  [x.x.x] PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    2e-14  27%  2q0nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    2e-14  27%  2j0iA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    2e-14  35%  2g9xC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-14  39%  3eidA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-14  27%  2cdzA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    3e-14  34%  2vd5B  [x.x.x] DMPK PROTEIN
    3e-14  28%  2uztA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-14  36%  3fe3A  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    3e-14  40%  3eqiA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    3e-14  40%  3eqfA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    4e-14  40%  1y91A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-14  34%  3dbqA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    4e-14  29%  2bvaB  [x.x.x] P21-ACTIVATED KINASE 4
    4e-14  29%  2bvaA  [x.x.x] P21-ACTIVATED KINASE 4
    5e-14  35%  2zmcA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    5e-14  38%  1w98A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  41%  1vyzA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1oiyA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1oiuC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1oi9A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1oguC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1oguA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1jsuA  [d.144.1] CYCLIN-DEPENDENT KINASE-2
    5e-14  38%  1jstA  [d.144.1] CYCLIN-DEPENDENT KINASE-2
    5e-14  38%  2jgzA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2iw9C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2iw9A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2iw8C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2iw8A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2iw6C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2iw6A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1h27C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1h26C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1h25C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  1h24A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  39%  1h0vA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  40%  1h08A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2g9xA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  40%  3fz1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  36%  2f7xE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    5e-14  38%  1e9hA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  3dogC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  3dogA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  3ddqC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  3ddqA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2cjmC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2cjmA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  2cchA  [d.144.1 (1e9hC)] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  3bhuC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  3bhtC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-14  38%  3bhtA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-14  38%  2i40A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-14  41%  2vtsA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-14  41%  2vtoA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-14  32%  2j4zB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    9e-14  32%  2j4zA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    9e-14  40%  2hakA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    9e-14  36%  3c4cA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    1e-13  42%  2vtiA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-13  42%  2uznA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-13  42%  1jvpP  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-13  33%  2iwiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PIM-2
    1e-13  33%  2iwiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PIM-2
    1e-13  41%  1fvtA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-13  41%  2w06A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-13  41%  2vtpA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-13  34%  2vrxB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    2e-13  34%  2vgpB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    2e-13  34%  2vgpA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    2e-13  34%  2vgoB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    2e-13  34%  2vgoA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    2e-13  36%  1v0oB  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    2e-13  36%  1v0oA  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    2e-13  36%  1v0bA  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    2e-13  33%  1mq4A  [d.144.1] AURORA-RELATED KINASE 1
    2e-13  32%  3h10B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-13  32%  3h10A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-13  38%  2fvdA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-13  28%  2f57B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 7
    2e-13  28%  2f57A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 7
    2e-13  33%  3e5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-13  41%  1di8A  [d.144.1] CYCLIN-DEPENDENT KINASE 2
    2e-13  34%  2bfyB  [x.x.x] LOC398457 PROTEIN
    2e-13  34%  2bfyA  [x.x.x] LOC398457 PROTEIN
    2e-13  34%  2bfxB  [x.x.x] LOC398457 PROTEIN
    2e-13  34%  2bfxA  [x.x.x] LOC398457 PROTEIN
    2e-13  36%  2acxB  [x.x.x] G PROTEIN-COUPLED RECEPTOR KINASE 6
    2e-13  36%  2acxA  [x.x.x] G PROTEIN-COUPLED RECEPTOR KINASE 6
    2e-13  36%  2weiA  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1, PUTATIVE
    2e-13  44%  2w7xA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    2e-13  35%  1j3hB  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  35%  1j3hA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  35%  3gfwA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    2e-13  44%  2cn5A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    3e-13  41%  1wccA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-13  41%  2vthA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-13  30%  2r5tA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    3e-13  33%  1ol7A  [d.144.1] SERINE/THREONINE KINASE 6
    3e-13  33%  1ol5A  [d.144.1] SERINE/THREONINE KINASE 6
    3e-13  41%  1ke6A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-13  30%  3hdnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    3e-13  30%  3hdmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    3e-13  33%  3ha6A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-13  41%  1giiA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-13  36%  3fxzA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    3e-13  41%  1ckpA  [d.144.1] PROTEIN (CYCLIN-DEPENDENT PROTEIN KINASE 2)
    4e-13  33%  1yhwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    4e-13  41%  3ig7A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-13  36%  3c4cB  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    4e-13  32%  2bdwB  [x.x.x] HYPOTHETICAL PROTEIN K11E8.1D
    4e-13  32%  2bdwA  [x.x.x] HYPOTHETICAL PROTEIN K11E8.1D
    5e-13  34%  1zysA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  33%  1yhvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    5e-13  34%  1xh9A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    5e-13  34%  2wmxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2wmwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2wmvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2wmuA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2wmtA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2wmsA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2wmrA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2wmqA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2r0uA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2qhnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  28%  2ozaA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    5e-13  34%  1nvrA  [d.144.1] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  3jvsA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  3jvrA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  1ia8A  [d.144.1] CHK1 CHECKPOINT KINASE
    5e-13  34%  2hogA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  40%  1h0wA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-13  34%  2gdoA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  3f9nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2e9nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  40%  3dxnA  [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3
    5e-13  34%  2cgxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2cgwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2cgvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2cguA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2c3lA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2c3kA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2c3jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2brnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2brmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2brhA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2brgA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-13  34%  2aypA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    6e-13  34%  2zmdA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    6e-13  37%  1f3mC  [d.144.1] SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
    8e-13  27%  1ydrE  [d.144.1] C-AMP-DEPENDENT PROTEIN KINASE
    8e-13  38%  2vu3A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-13  34%  2vo6A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-13  34%  2vo0A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-13  39%  1v0bB  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    8e-13  34%  2uw4A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-13  34%  2uvzA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-13  34%  2uvyA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-13  34%  2uvxA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-13  34%  1szmB  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-13  34%  1szmA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-13  40%  1s9jA  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    8e-13  39%  2r3nA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-13  34%  2qluA  [x.x.x] ACTIVIN RECEPTOR TYPE IIB
    8e-13  34%  1q61A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-13  34%  2jdtA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE
    8e-13  38%  1h07A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    8e-13  43%  2fh9A  [x.x.x] SNF1 KINASE
    8e-13  40%  3eqcA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    8e-13  40%  3e8nA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    8e-13  40%  3dv3A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    8e-13  27%  3dneA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-13  27%  3dndA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-13  36%  3d2iA  [x.x.x] SERINE/THREONINE KINASE 6
    8e-13  27%  1cmkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-13  27%  1cdkA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-12  41%  2w17A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-12  41%  2vv9A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-12  42%  1s9iA  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    1e-12  39%  2r3lA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-12  38%  2r3kA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-12  43%  2qkwB  [x.x.x] PROTEIN KINASE
    1e-12  39%  1ob3A  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    1e-12  33%  1o6lA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    1e-12  33%  1o6kA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    1e-12  45%  2nryC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-12  33%  2jdoA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-12  33%  3e8dB  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-12  33%  3e8dA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-12  33%  3e88A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-12  33%  3e87A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-12  43%  3dy7A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    1e-12  36%  3d15A  [x.x.x] SERINE/THREONINE KINASE 6
    1e-12  33%  3d0eA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-12  38%  1xo2B  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    1e-12  34%  1xh8A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  1xh7A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  1xh6A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  1u7eA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  1stcE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-12  33%  1smhA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  1rejA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  38%  2r3jA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-12  34%  2qvsE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  2qurA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  2qcsA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  32%  1qcfA  [b.34.2 - d.93.1 - d.144.1] HAEMATOPOETIC CELL KINASE (HCK)
    1e-12  34%  1q8wA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  1q8uA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  1q8tA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  1pmqA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-12  41%  1p2aA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-12  45%  2oicD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-12  42%  2oibD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-12  36%  1muoA  [d.144.1] AURORA-RELATED KINASE 1
    1e-12  34%  1l3rE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  38%  1jowB  [d.144.1] CELL DIVISION PROTEIN KINASE 6
    1e-12  34%  1jbpE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  34%  3idbA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-12  39%  3hztA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE 3
    1e-12  32%  2hk5A  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    1e-12  43%  3hgkC  [x.x.x] PROTEIN KINASE
    1e-12  43%  3hgkB  [x.x.x] PROTEIN KINASE
    1e-12  43%  3hgkA  [x.x.x] PROTEIN KINASE
    1e-12  40%  2h34A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNE
    1e-12  40%  1h00A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-12  34%  2gu8A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  41%  1gijA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-12  41%  1gihA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-12  38%  1g3nA  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    1e-12  34%  1fmoE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-12  34%  3fjqE  [d.144.1 (1atpE)] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC
    1e-12  34%  3fhiA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-12  38%  2f2cB  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    1e-12  38%  2eufB  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    1e-12  34%  3e8eI  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-12  34%  3e8cE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-12  34%  3e8cB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-12  34%  3dakD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    1e-12  34%  1ctpE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-12  34%  2cpkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, CATALYTIC SUBUNIT
    1e-12  34%  2c1aA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE
    1e-12  34%  3bwjA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-12  38%  1blxA  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    1e-12  34%  1bkxA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-12  38%  1bi8A  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    1e-12  38%  1bi7A  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    1e-12  34%  1apmE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    2e-12  42%  2yzaA  [x.x.x] 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC
    2e-12  36%  2w1eA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-12  34%  2vwiC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    2e-12  40%  1urwA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-12  40%  1oitA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-12  46%  2nruB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-12  46%  2nruA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-12  33%  3hmmA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    2e-12  34%  2gnlA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  34%  2gnjA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  34%  2gngA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  34%  2gnfA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  35%  3fdnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-12  35%  3dj5A  [x.x.x] SERINE/THREONINE KINASE 6
    2e-12  32%  3bhhD  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-12  32%  3bhhC  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-12  32%  3bhhB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-12  32%  3bhhA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-12  31%  2welA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-12  35%  2w1gA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-12  36%  2w1fA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-12  31%  2vn9A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-12  33%  1q62A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  33%  1q24A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  34%  3i79A  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    2e-12  34%  3hx4A  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    2e-12  38%  2hakD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    2e-12  38%  2hakC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    2e-12  35%  3dj7A  [x.x.x] SERINE/THREONINE KINASE 6
    2e-12  35%  3d14A  [x.x.x] SERINE/THREONINE KINASE 6
    2e-12  36%  2c6dA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-12  40%  2vz6B  [x.x.x] CALCIUM CALMODULIN DEPENDENT PROTEIN KINASE TYPE
    3e-12  40%  2vz6A  [x.x.x] CALCIUM CALMODULIN DEPENDENT PROTEIN KINASE TYPE
    3e-12  33%  1sykB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-12  33%  1sykA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-12  28%  2qg5D  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    3e-12  28%  2qg5B  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    3e-12  28%  2qg5A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    3e-12  45%  2oibC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    3e-12  32%  3faaA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    3e-12  28%  3f3zA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE WITH
    3e-12  33%  3c0iA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    3e-12  33%  3c0hA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    3e-12  33%  3c0gB  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    3e-12  33%  3c0gA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    4e-12  40%  2w05A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-12  39%  1ob3B  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    4e-12  44%  2nryA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    4e-12  36%  2np8A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-12  40%  1g5sA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-12  40%  3ezvA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-12  40%  1aq1A  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE 2
    5e-12  42%  1zycA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    5e-12  32%  2vd5A  [x.x.x] DMPK PROTEIN
    5e-12  39%  1v1kA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-12  37%  2pmiC  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    5e-12  37%  2pmiA  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    5e-12  37%  2pk9C  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    5e-12  37%  2pk9A  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    5e-12  44%  2oidD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    5e-12  43%  2oidA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    5e-12  43%  2oibB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    5e-12  43%  2oibA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    5e-12  37%  2j50A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-12  36%  3h9fA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    5e-12  35%  3h10D  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-12  39%  2btrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-12  42%  1zycB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    7e-12  35%  2w5bA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    7e-12  40%  2vtjA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-12  32%  3fpmA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    7e-12  36%  3e7oA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 9
    7e-12  40%  2duvA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-12  35%  2c6eA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    7e-12  39%  2b52A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-12  42%  1zy4A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    9e-12  34%  1ym7D  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    9e-12  34%  1ym7C  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    9e-12  34%  1ym7A  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    9e-12  29%  1y57A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-12  29%  2srcA  [x.x.x] TYROSINE-PROTEIN KINASE SRC
    9e-12  41%  2r0iA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK2
    9e-12  34%  1omwA  [a.91.1 - d.144.1 - b.55.1] G-PROTEIN COUPLED RECEPTOR KINASE
    9e-12  44%  2nryD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    9e-12  36%  1mryA  [d.144.1] RAC-BETA SERINE/THREONINE KINASE
    9e-12  29%  1kswA  [b.34.2 - d.93.1 - d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN
    9e-12  29%  2h8hA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-12  34%  3cikA  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    9e-12  35%  3cekA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    9e-12  34%  2bcjA  [x.x.x] G-PROTEIN COUPLED RECEPTOR KINASE 2
    1e-11  44%  1zydB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    1e-11  42%  1zycD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    1e-11  42%  1zycC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    1e-11  32%  2wouA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    1e-11  32%  2wotA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    1e-11  34%  2wajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-11  39%  2vtqA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-11  31%  2v7oA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    1e-11  32%  1py5A  [d.144.1] TGF-BETA RECEPTOR TYPE I
    1e-11  30%  1ny3A  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-11  38%  2jamB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    1e-11  38%  2jamA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    1e-11  32%  1iasA  [d.144.1] TGF-BETA RECEPTOR TYPE I
    1e-11  39%  2h6dA  [x.x.x] 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC
    1e-11  38%  3g33A  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    1e-11  35%  2bmcF  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    1e-11  35%  2bmcC  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    1e-11  35%  2bmcB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    1e-11  35%  2bmcA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    1e-11  32%  1b6cB  [d.144.1] TGF-B SUPERFAMILY RECEPTOR TYPE I
    1e-11  39%  2b55A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-11  34%  2zdtA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-11  31%  1wmkH  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-11  31%  1wmkB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-11  31%  1wmkE  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-11  31%  1wmkA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-11  39%  2vttA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-11  40%  2vtnA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-11  33%  1rdqE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-11  40%  1r78A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-11  31%  2pzyB  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-11  34%  1pmvA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-11  34%  1pmnA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-11  32%  2pl0A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-11  34%  2p33A  [x.x.x] C-JUN N-TERMINAL KINASE 3
    1e-11  44%  2oidC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-11  44%  2oidB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-11  44%  2oicB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-11  44%  2oicA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-11  32%  2of2A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-11  34%  1jnkA  [x.x.x] C-JUN N-TERMINAL KINASE
    1e-11  33%  2jedB  [x.x.x] PROTEIN KINASE C THETA
    1e-11  33%  2jedA  [x.x.x] PROTEIN KINASE C THETA
    1e-11  39%  2j9mA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-11  34%  3g9nA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-11  34%  3g90X  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-11  33%  3dakC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    1e-11  39%  2btsA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-11  39%  2bheA  [d.144.1 (1dm2A)] CELL DIVISION PROTEIN KINASE 2
    1e-11  31%  2a27A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-11  38%  2w9fB  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    2e-11  37%  2w1dA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-11  40%  1oiqA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-11  32%  2dwbA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-11  31%  1zwsA  [x.x.x] DAP-KINASE RELATED PROTEIN 1
    3e-11  36%  2w96B  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    3e-11  44%  2w0jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    3e-11  30%  1vjyA  [d.144.1] TGF-BETA RECEPTOR TYPE I
    3e-11  37%  2ow3B  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-11  37%  2ow3A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-11  37%  1o9uA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-11  34%  2o0uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-11  32%  2jbpG  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    3e-11  31%  2jbpC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    3e-11  37%  3igoA  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    3e-11  30%  1iasB  [d.144.1] TGF-BETA RECEPTOR TYPE I
    3e-11  28%  2i0eB  [x.x.x] PROTEIN KINASE C-BETA II
    3e-11  28%  2i0eA  [x.x.x] PROTEIN KINASE C-BETA II
    3e-11  37%  1gngB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-11  37%  1gngA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-11  37%  3f88A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-11  37%  3f7zB  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-11  37%  3f7zA  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-11  31%  2ckeB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    3e-11  31%  2ckeA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    3e-11  31%  2c47D  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    3e-11  31%  2a2aB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    3e-11  31%  2a2aA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    3e-11  35%  2vwiD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    3e-11  31%  2v5qA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    3e-11  42%  1s9iB  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    3e-11  36%  1q3wB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-11  34%  3gxlA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    3e-11  36%  3gbzA  [x.x.x] KINASE, CMGC CDK
    3e-11  36%  1f3mD  [d.144.1] SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
    3e-11  33%  3cqwA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    3e-11  33%  3cquA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    4e-11  43%  1zydA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    4e-11  37%  2w9zB  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    4e-11  37%  2w99B  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    4e-11  34%  1ukiA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 8 ISOFORM 4
    4e-11  45%  2o8yB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    4e-11  31%  2jbpH  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    4e-11  42%  3hyhA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    4e-11  32%  2h96A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    4e-11  35%  3h0zA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-11  35%  3h0yA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-11  32%  2gmxB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    4e-11  32%  2gmxA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    4e-11  32%  2g01B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    4e-11  32%  2g01A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    4e-11  42%  3famB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    4e-11  42%  2eueB  [x.x.x] CARBON CATABOLITE DEREPRESSING PROTEIN KINASE
    4e-11  31%  2c47B  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    4e-11  31%  2c47A  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    4e-11  34%  3bqrA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    6e-11  35%  2zduA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    6e-11  33%  1yxsA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    6e-11  33%  1ywvA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    6e-11  33%  1xwsA  [d.144.1] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    6e-11  33%  1xqzA  [d.144.1] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    6e-11  42%  2qkrA  [x.x.x] CDC2-LIKE CDK2/CDC28 LIKE PROTEIN KINASE
    6e-11  35%  2ok1A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    6e-11  35%  2o2uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    6e-11  28%  2jfmA  [x.x.x] STE20-LIKE SERINE-THREONINE KINASE
    6e-11  43%  3hyhB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    6e-11  34%  3gqiA  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    6e-11  43%  3famA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    6e-11  35%  2excX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    6e-11  35%  3da6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    6e-11  38%  2cl1A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    6e-11  30%  3ckxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    6e-11  33%  3c4eC  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  30%  1yi6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-11  33%  2vwiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    7e-11  27%  2uv2A  [x.x.x] STE20-LIKE SERINE-THREONINE KINASE
    7e-11  37%  1uv5A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  31%  2rkuA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    7e-11  37%  1r0eA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1q5kB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1q5kA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1q4lB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1q4lA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1q41B  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1q41A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1q3wA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1q3dB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1q3dA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1pyxB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1pyxA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  31%  2ou7A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    7e-11  35%  2objA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  37%  2o5kA  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  2jldB  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  2jldA  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  27%  2j51A  [x.x.x] STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
    7e-11  35%  2j2iB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  37%  1j1bB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1j1bA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1i09B  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1i09A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1h8fB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  37%  1h8fA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  36%  1gzkA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    7e-11  33%  3g9lX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    7e-11  31%  3fc2A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    7e-11  35%  3f2aA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  31%  3eljA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    7e-11  37%  3du8A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-11  35%  3dcvA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  30%  3d5uA  [x.x.x] POLO-LIKE KINASE 1
    7e-11  35%  3cy3A  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  35%  3cy2A  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  35%  3cxwA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  35%  2c3iB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    7e-11  35%  2bzkB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    7e-11  35%  2bzhB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    7e-11  35%  2bilB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  35%  2bikB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-11  35%  3bgzA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-10  37%  2qr8A  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-3
    1e-10  34%  1pmuA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-10  40%  1k9aE  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    1e-10  40%  1k9aD  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    1e-10  31%  2jbpI  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-10  31%  2jbpF  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-10  31%  2jbpD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-10  39%  2hakG  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    1e-10  34%  2fgiA  [d.144.1] PROTEIN (FIBROBLAST GROWTH FACTOR (FGF) RECEPTOR
    1e-10  35%  2evaA  [x.x.x] TAK1 KINASE - TAB1 CHIMERA FUSION PROTEIN
    1e-10  30%  3db6A  [x.x.x] POLO-LIKE KINASE 1
    1e-10  42%  3daeB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    1e-10  42%  3daeA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    1e-10  31%  2cmwA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-1
    1e-10  39%  2w5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    1e-10  34%  1ukhA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 8 ISOFORM 4
    1e-10  34%  1qpjA  [d.144.1] LCK TYROSINE KINASE
    1e-10  34%  1qpdA  [d.144.1] LCK KINASE
    1e-10  34%  1qpcA  [d.144.1] LCK KINASE
    1e-10  44%  2oicC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-10  34%  2ofuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-10  28%  2jflA  [x.x.x] STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
    1e-10  40%  3dtcA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 9
    1e-10  30%  3dqwD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-10  30%  3dqwC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-10  30%  3dqwA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-10  41%  3cokA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK4
    1e-10  34%  3cohA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-10  34%  3bymA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-10  36%  1ad5A  [b.34.2 - d.93.1 - d.144.1] HAEMATOPOETIC CELL KINASE HCK
    2e-10  45%  1zy4B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    2e-10  33%  2zoqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 3
    2e-10  39%  1pyeA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-10  35%  2onlD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-10  35%  2onlC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-10  31%  2jbpE  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-10  34%  1h4lA  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    2e-10  33%  3dakA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    2e-10  41%  1cm8A  [d.144.1] PHOSPHORYLATED MAP KINASE P38-GAMMA
    2e-10  30%  2c47C  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    2e-10  36%  1zmwB  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    2e-10  36%  1zmwA  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    2e-10  32%  1yrpA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    2e-10  46%  2w4oA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-10  30%  2pzyD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-10  41%  1k9aA  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    2e-10  30%  2jboA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-10  32%  2j90B  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    2e-10  33%  3gxjA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    2e-10  41%  3d7uA  [x.x.x] TYROSINE-PROTEIN KINASE CSK
    2e-10  29%  3d5wA  [x.x.x] POLO-LIKE KINASE 1
    2e-10  33%  3b2wA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    3e-10  33%  2pvfA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    3e-10  31%  2oh4A  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    3e-10  44%  2o8yA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    3e-10  41%  1k9aC  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    3e-10  40%  3ezrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-10  33%  3clyA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    3e-10  35%  2c6eB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-10  40%  1zmvB  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    4e-10  40%  1zmvA  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    4e-10  40%  1zmuB  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    4e-10  40%  1zmuA  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    4e-10  31%  1xjdA  [d.144.1] PROTEIN KINASE C, THETA TYPE
    4e-10  37%  2w5hA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    4e-10  31%  2pzyC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    4e-10  31%  2pzyA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    4e-10  40%  2ozaB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-10  31%  2jbpB  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    4e-10  41%  3g2fB  [x.x.x] BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE-2
    4e-10  36%  2cn8A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    4e-10  35%  2c0tB  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    4e-10  35%  2c0tA  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    4e-10  35%  2c0iA  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    4e-10  35%  3bceB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    4e-10  35%  3bceA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    5e-10  45%  1zy5B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    5e-10  37%  1ql6A  [d.144.1] PHOSPHORYLASE KINASE
    5e-10  31%  3hkoA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE WITH
    5e-10  30%  2g2iB  [x.x.x] ABL TYROSINE KINASE
    5e-10  30%  2g2iA  [x.x.x] ABL TYROSINE KINASE
    5e-10  30%  2g2hA  [x.x.x] ABL TYROSINE
    5e-10  30%  2g2fB  [x.x.x] ABL KINASE
    5e-10  30%  2g2fA  [x.x.x] ABL KINASE
    5e-10  33%  2fysB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    5e-10  34%  1fgiA  [d.144.1] FGF RECEPTOR 1
    5e-10  30%  2f4jA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-10  33%  3eb0C  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-10  33%  3eb0A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-10  30%  3dk3B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-10  30%  3dk3A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-10  38%  3dajA  [x.x.x] SERINE/THREONINE KINASE 6
    5e-10  34%  3c4fA  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    5e-10  34%  1agwA  [d.144.1] FGF RECEPTOR 1
    6e-10  30%  2z60A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  34%  1wvyA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    6e-10  34%  1wvwA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    6e-10  35%  2vwiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    6e-10  33%  1unlA  [d.144.1] CYCLIN-DEPENDENT KINASE 5
    6e-10  33%  1unhA  [d.144.1] CYCLIN-DEPENDENT KINASE 5
    6e-10  33%  1ungB  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    6e-10  33%  1ungA  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    6e-10  30%  2qohB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2qohA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  1opjB  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  1opjA  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  35%  2ogvA  [x.x.x] MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR
    6e-10  30%  1m52B  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  1m52A  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  40%  1k9aB  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    6e-10  32%  1k2pA  [d.144.1] TYROSINE-PROTEIN KINASE BTK
    6e-10  34%  1jktA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE
    6e-10  34%  1jkkA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE
    6e-10  34%  1ig1A  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE
    6e-10  30%  1iepA  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
    6e-10  35%  2i1mA  [x.x.x] MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR
    6e-10  30%  2hznA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hziB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hziA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hz4C  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hz4B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hz4A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hz0A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hyyD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hyyB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hyyA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2hiwA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  42%  3gcuA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-10  39%  3g2fA  [x.x.x] BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE-2
    6e-10  30%  2g1tD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2g1tC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2g1tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  2g1tA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  1fpuA  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
    6e-10  34%  3ehaA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    6e-10  34%  3eh9A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    6e-10  32%  2dq7X  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FYN
    6e-10  28%  3dkcA  [x.x.x] MET PROTO-ONCOGENE
    6e-10  34%  3dgkA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    6e-10  34%  3dfcB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    6e-10  35%  3dakB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    6e-10  30%  3cs9D  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  30%  3cs9A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-10  35%  3beaA  [x.x.x] MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR
    8e-10  35%  1yhsA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    8e-10  38%  1y8gB  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 2
    8e-10  38%  1y8gA  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 2
    8e-10  29%  1r0pA  [d.144.1] HEPATOCYTE GROWTH FACTOR RECEPTOR
    8e-10  30%  1q8yA  [d.144.1] SR PROTEIN KINASE
    8e-10  32%  1p4oB  [d.144.1] INSULIN-LIKE GROWTH FACTOR I RECEPTOR PROTEIN
    8e-10  32%  1p4oA  [d.144.1] INSULIN-LIKE GROWTH FACTOR I RECEPTOR PROTEIN
    8e-10  34%  1ol6A  [d.144.1] SERINE/THREONINE KINASE 6
    8e-10  32%  2oj9A  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR PRECURSOR
    8e-10  32%  1m7nA  [d.144.1] INSULIN-LIKE GROWTH FACTOR I RECEPTOR
    8e-10  40%  1lezA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-10  30%  2jd5A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SKY1
    8e-10  36%  2j90A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    8e-10  32%  2i0yA  [x.x.x] CFMS TYROSINE KINASE
    8e-10  32%  2i0vA  [x.x.x] CFMS TYROSINE KINASE
    8e-10  34%  3ggfB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MST4
    8e-10  34%  3ggfA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MST4
    8e-10  41%  3gcvA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-10  41%  3gcqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-10  33%  3g5dB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-10  33%  3g5dA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-10  33%  3f3tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-10  33%  2erkA  [x.x.x] EXTRACELLULAR SIGNAL-REGULATED KINASE 2
    8e-10  33%  3el8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-10  33%  3el8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-10  31%  3blhA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    8e-10  33%  3bceC  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    8e-10  34%  2b1pA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    8e-10  34%  1agwB  [d.144.1] FGF RECEPTOR 1
    1e-09  32%  2oiqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-09  30%  3gc9B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    1e-09  31%  3gc9A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    1e-09  33%  2fysA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    1e-09  29%  3e63A  [x.x.x] TYROSINE-PROTEIN KINASE JAK2
    1e-09  29%  3e62A  [x.x.x] TYROSINE-PROTEIN KINASE JAK2
    1e-09  39%  3coiA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 13
    1e-09  29%  2b7aB  [x.x.x] TYROSINE-PROTEIN KINASE JAK2
    1e-09  29%  2b7aA  [x.x.x] TYROSINE-PROTEIN KINASE JAK2
    1e-09  34%  2z7lA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    1e-09  28%  2wgjA  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    1e-09  28%  2wd1A  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    1e-09  34%  1tvoA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    1e-09  36%  2r4bB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    1e-09  36%  2r4bA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    1e-09  36%  2phkA  [d.144.1] PHOSPHORYLASE KINASE
    1e-09  36%  1phkA  [x.x.x] PHOSPHORYLASE KINASE
    1e-09  34%  2ojiA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    1e-09  34%  2ojgA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    1e-09  38%  1k9aF  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    1e-09  31%  2i6lA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 6
    1e-09  34%  2gphA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    1e-09  34%  1golA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    1e-09  28%  2g15A  [x.x.x] ACTIVATED MET ONCOGENE
    1e-09  34%  3erkA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    1e-09  34%  1erkA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    1e-09  38%  3e7oB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 9
    1e-09  43%  2dylA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    1e-09  33%  3comB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    1e-09  33%  3comA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    2e-09  41%  2puuA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-09  36%  1mrvA  [d.144.1] RAC-BETA SERINE/THREONINE KINASE
    2e-09  29%  1koaA  [x.x.x] TWITCHIN
    2e-09  27%  2j7tA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 10
    2e-09  41%  3hp5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-09  34%  3h0zC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-09  34%  3h0zB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-09  29%  3gp0A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    2e-09  27%  3gc8B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    2e-09  27%  3gc8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    2e-09  29%  3etaA  [x.x.x] INSULIN RECEPTOR, KINASE DOMAIN
    2e-09  31%  3dfaA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE CGD3_920
    2e-09  38%  3d2kA  [x.x.x] SERINE/THREONINE KINASE 6
    2e-09  41%  3ctqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-09  39%  1bygA  [d.144.1] PROTEIN (C-TERMINAL SRC KINASE)
    2e-09  35%  3bhyA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    2e-09  41%  2bakA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-09  41%  2qd9A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-09  33%  1p4fA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE 1
    2e-09  29%  1oplB  [d.93.1 - d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE
    2e-09  29%  1oplA  [b.34.2 - d.93.1 - d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN
    2e-09  29%  1opkA  [b.34.2 - d.93.1 - d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN
    2e-09  32%  2jbpA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-09  29%  3hmiA  [x.x.x] TYROSINE-PROTEIN KINASE ABL2
    2e-09  36%  2gtmA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-09  37%  3gc0A  [x.x.x] KINASE, CMGC CDK
    2e-09  32%  3g6hA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-09  29%  2fo0A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1 (1B
    2e-09  32%  3f6xD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-09  32%  3f6xC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-09  32%  3f6xA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-09  31%  2eb2A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-09  30%  3dqxB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-09  31%  3dqxA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-09  38%  2clqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 5
    2e-09  31%  2bdfB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-09  41%  1zz2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  32%  2zvaA  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    3e-09  33%  2zv7A  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    3e-09  40%  1ywrA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  29%  2v7aB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  29%  2v7aA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  34%  1t46A  [d.144.1] HOMO SAPIENS V-KIT HARDY-ZUCKERMAN 4 FELINE
    3e-09  34%  1t45A  [d.144.1] HOMO SAPIENS V-KIT HARDY-ZUCKERMAN 4 FELINE
    3e-09  34%  2rf9B  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-09  33%  2qi8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-09  33%  2pvyD  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    3e-09  33%  2pvyA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    3e-09  34%  1pkgA  [d.144.1] C-KIT PROTEIN
    3e-09  38%  2og8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    3e-09  38%  2ofvA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    3e-09  40%  1lewA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  37%  2javA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    3e-09  41%  3hl7A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  36%  3gt8C  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-09  41%  2gtnA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  36%  3gqlA  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    3e-09  29%  2gqgB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  29%  2gqgA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  40%  3gcpA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  34%  3g0fB  [x.x.x] MAST/STEM CELL GROWTH FACTOR RECEPTOR
    3e-09  34%  3g0fA  [x.x.x] MAST/STEM CELL GROWTH FACTOR RECEPTOR
    3e-09  34%  3g0eA  [x.x.x] MAST/STEM CELL GROWTH FACTOR RECEPTOR
    3e-09  34%  3fv8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-09  34%  3fi2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-09  37%  2e14A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    3e-09  34%  3dpkA  [x.x.x] MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR
    3e-09  29%  3dk7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  29%  3dk7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  29%  3dk6B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  29%  3dk6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  39%  3cokB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK4
    3e-09  35%  3c9wA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    3e-09  41%  3bv3A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  31%  2bdjA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-09  31%  2bdfA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-09  34%  2bajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-09  38%  1ua2A  [d.144.1] CELL DIVISION PROTEIN KINASE 7
    4e-09  41%  2rg6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-09  31%  2r2pA  [x.x.x] EPHRIN TYPE-A RECEPTOR 5
    4e-09  32%  2qlqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-09  33%  2q0bB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2q0bA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2pzpB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2pzpA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2pz5B  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2pz5A  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2py3B  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2py3A  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2pwlB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2pwlA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2psqB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  2psqA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  41%  2okrA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-09  33%  1m17A  [d.144.1] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  1m14A  [d.144.1] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2jiuB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2jiuA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2jitB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2jitA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2j6mA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2j5eA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2itwA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2itqA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2itpA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR PRECURSOR
    4e-09  43%  2hw7A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    4e-09  42%  2hakH  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    4e-09  42%  2hakB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    4e-09  33%  2gs6A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  2gs2A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-09  33%  1gjoA  [d.144.1] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  41%  2ghlA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-09  33%  3geqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-09  32%  1fmkA  [x.x.x] TYROSINE-PROTEIN KINASE SRC
    4e-09  31%  3f6xB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-09  31%  3eyhA  [x.x.x] TYROSINE-PROTEIN KINASE
    4e-09  31%  3eygA  [x.x.x] TYROSINE-PROTEIN KINASE
    4e-09  29%  3etaB  [x.x.x] INSULIN RECEPTOR, KINASE DOMAIN
    4e-09  31%  3d7tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-09  29%  3cd8A  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    4e-09  29%  3ccnA  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    4e-09  41%  3bv2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-09  39%  3bbwA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    4e-09  39%  3bbwB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    4e-09  39%  3bbtB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    4e-09  33%  3b2tB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-09  33%  3b2tA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    5e-09  33%  2zm3D  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  2zm3C  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  2zm3B  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  2zm3A  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  32%  2qq7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-09  32%  2qi8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-09  30%  1q8zA  [d.144.1] SR PROTEIN KINASE
    5e-09  41%  2okrD  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-09  31%  2oiqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-09  33%  1k3aA  [d.144.1] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  1jqhB  [d.144.1] IGF-1 RECEPTOR KINASE
    5e-09  33%  1jqhA  [d.144.1] IGF-1 RECEPTOR KINASE
    5e-09  28%  2izuA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-3
    5e-09  28%  2iztA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-3
    5e-09  28%  2izrA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-3
    5e-09  31%  2hyyC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-09  34%  3gc7A  [d.144.1 (1oveA)] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-09  33%  3f5pS  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  3f5pM  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  3f5pI  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  3f5pE  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  3f5pD  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  3f5pC  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  3f5pB  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  33%  3f5pA  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  40%  3e3pB  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    5e-09  40%  3e3pA  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    5e-09  40%  3ds6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-09  28%  2chlA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-3
    5e-09  41%  3bbtD  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    5e-09  42%  2ac5A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    7e-09  40%  1zyjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-09  32%  2zv9A  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    7e-09  33%  1rjbA  [d.144.1] FL CYTOKINE RECEPTOR
    7e-09  35%  2p2iA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    7e-09  35%  2ofvB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    7e-09  36%  3gqlC  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    7e-09  36%  3gqlB  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    7e-09  28%  3fy2A  [x.x.x] EPHRIN TYPE-A RECEPTOR 3
    7e-09  32%  1fpuB  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
    7e-09  34%  3fi3A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    7e-09  31%  3en4B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-09  32%  2e2bB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    7e-09  32%  2e2bA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    7e-09  39%  2clqB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 5
    7e-09  36%  2bujB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 16
    9e-09  40%  2zb1A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-09  29%  2rfsA  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    9e-09  38%  2rfeD  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-09  38%  2rfeC  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-09  38%  2rfeB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-09  38%  2rfdA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-09  35%  2r9sA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    9e-09  31%  1r1wA  [d.144.1] HEPATOCYTE GROWTH FACTOR RECEPTOR
    9e-09  35%  2qu5A  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    9e-09  32%  2pzrB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    9e-09  32%  2pzrA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    9e-09  33%  2pvyC  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    9e-09  37%  2ityA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-09  34%  2itoA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-09  34%  2itnA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-09  40%  3hp2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-09  40%  3hllA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-09  40%  2ghmA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-09  27%  3f66A  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    9e-09  40%  3c5uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-09  39%  2ac3A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    1e-08  34%  2zb0A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  34%  2zazA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  34%  1yqjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  34%  1wbsA  [d.144.1 (1bl6A)] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  31%  1u59A  [d.144.1] TYROSINE-PROTEIN KINASE ZAP-70
    1e-08  40%  2rg5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  31%  2rf9A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    1e-08  32%  2qq7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  33%  2ptkA  [x.x.x] TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
    1e-08  34%  1oz1A  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  34%  1ouyA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  40%  2onlA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  37%  2og8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-08  31%  2jbpL  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-08  34%  3hrbA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  34%  3gfeA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  32%  3geqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  32%  3g6hB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  31%  3fqeA  [x.x.x] TYROSINE-PROTEIN KINASE SYK
    1e-08  33%  3f3wB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  33%  3f3wA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  33%  3f3vB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  33%  3f3uB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  33%  3f3tA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  32%  3ewhA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    1e-08  32%  3en5B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  34%  1di9A  [d.144.1] P38 KINASE
    1e-08  34%  3d7zA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  36%  3byuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-08  37%  3bysA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-08  37%  2bujA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 16
    1e-08  34%  1bmkA  [d.144.1] PROTEIN (MAP KINASE P38)
    2e-08  40%  1yw2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  29%  1yvjA  [x.x.x] TYROSINE-PROTEIN KINASE JAK3
    2e-08  36%  1xkkA  [d.144.1] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-08  31%  1xbcA  [d.144.1] TYROSINE-PROTEIN KINASE SYK
    2e-08  31%  1xbaA  [d.144.1] TYROSINE-PROTEIN KINASE SYK
    2e-08  36%  2rgpA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-08  34%  1pmeA  [x.x.x] ERK2
    2e-08  40%  1kv1A  [d.144.1] P38 MAP KINASE
    2e-08  36%  2j5fA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-08  32%  2gs7B  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-08  31%  3fqhA  [x.x.x] TYROSINE-PROTEIN KINASE SYK
    2e-08  29%  3dbeA  [x.x.x] POLO-LIKE KINASE 1
    2e-08  39%  3d7tA  [x.x.x] TYROSINE-PROTEIN KINASE CSK
    2e-08  36%  3belA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-08  40%  1zxeD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    2e-08  29%  2vwxA  [x.x.x] EPHRIN TYPE-B RECEPTOR 4
    2e-08  36%  2rfeA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-08  33%  2rfdB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-08  40%  2pkjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  34%  2p2hA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    2e-08  34%  2jivB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-08  33%  2itxA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-08  34%  1howA  [d.144.1] SERINE/THREONINE-PROTEIN KINASE YMR216C
    2e-08  38%  3ha8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  33%  3gvuA  [x.x.x] TYROSINE-PROTEIN KINASE ABL2
    2e-08  28%  3f66B  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    2e-08  32%  3en4A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-08  41%  3bx5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-08  32%  1xbbA  [d.144.1] TYROSINE-PROTEIN KINASE SYK
    3e-08  30%  2vx0A  [x.x.x] EPHRIN TYPE-B RECEPTOR 4
    3e-08  32%  2qokA  [x.x.x] EPHRIN RECEPTOR
    3e-08  40%  2ptjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-08  37%  3k2lA  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    3e-08  27%  2j0lA  [x.x.x] FOCAL ADHESION KINASE 1
    3e-08  29%  1irkA  [x.x.x] INSULIN RECEPTOR TYROSINE KINASE DOMAIN
    3e-08  33%  2i6lB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 6
    3e-08  32%  2hwoA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  32%  2gs7A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-08  42%  3gcsA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-08  32%  3g6gB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  32%  3g6gA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  29%  3fxxA  [x.x.x] EPHRIN TYPE-A RECEPTOR 3
    3e-08  32%  3fqhB  [x.x.x] TYROSINE-PROTEIN KINASE SYK
    3e-08  32%  3emgA  [x.x.x] TYROSINE-PROTEIN KINASE SYK
    3e-08  32%  3el7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  33%  3dtwB  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    3e-08  41%  2baqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-08  36%  2wqeA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-08  41%  2wntB  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE
    3e-08  39%  2wntA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE
    3e-08  33%  2rl5A  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    3e-08  39%  1r39A  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-08  30%  2qocA  [x.x.x] EPHRIN RECEPTOR
    3e-08  31%  2pvyB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    3e-08  36%  2jivA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-08  30%  2ivvA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    3e-08  37%  2itzA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-08  34%  2itvA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-08  37%  2ituA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-08  34%  2ittA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-08  36%  3gt8D  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-08  36%  3gt8B  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-08  36%  3gt8A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-08  37%  3efwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-08  29%  3dkfA  [x.x.x] MET PROTO-ONCOGENE
    3e-08  32%  3d94A  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR BETA CHAIN
    3e-08  42%  2balA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-08  39%  1zxeC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    5e-08  34%  2ozoA  [x.x.x] TYROSINE-PROTEIN KINASE ZAP-70
    5e-08  32%  1kwpA  [d.144.1] MAP KINASE ACTIVATED PROTEIN KINASE 2
    5e-08  35%  2hz0B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-08  28%  3hngA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1
    5e-08  37%  3gopA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-08  40%  2ewaA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-08  36%  3efwB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-08  34%  3eflB  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    5e-08  36%  2eb3A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-08  28%  3dlsF  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    5e-08  28%  3dlsE  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    5e-08  28%  3dlsD  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    5e-08  28%  3dlsC  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    5e-08  28%  3dlsB  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    5e-08  28%  3dlsA  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    5e-08  30%  3dkgA  [x.x.x] MET PROTO-ONCOGENE
    5e-08  30%  3cthA  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    5e-08  34%  3cpcB  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    5e-08  34%  3cpbB  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    5e-08  34%  3cp9B  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    5e-08  34%  3cp9A  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    5e-08  30%  3ce3A  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    5e-08  34%  3b8rB  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    5e-08  34%  3b8rA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    5e-08  34%  3b8qB  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    6e-08  29%  2qonA  [x.x.x] EPHRIN RECEPTOR
    6e-08  35%  1q97B  [d.144.1] SR PROTEIN KINASE
    6e-08  35%  1q8zB  [d.144.1] SR PROTEIN KINASE
    6e-08  35%  1q8yB  [d.144.1] SR PROTEIN KINASE
    6e-08  42%  2p5aA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-08  35%  2jd5B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SKY1
    6e-08  30%  2ivuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    6e-08  30%  2ivtA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    6e-08  31%  2ivsA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    6e-08  29%  1csnA  [d.144.1 (1eh4A)] CASEIN KINASE-1
    6e-08  35%  2b9iA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    8e-08  30%  2qobA  [x.x.x] EPHRIN RECEPTOR
    8e-08  30%  2qo9A  [x.x.x] EPHRIN RECEPTOR
    8e-08  31%  2gsfA  [x.x.x] EPHRIN TYPE-A RECEPTOR 3
    8e-08  31%  3dzqA  [x.x.x] EPH RECEPTOR A3
    8e-08  39%  3cg2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-07  31%  1yomA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-07  31%  1yojB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-07  39%  2reiA  [x.x.x] EPHRIN TYPE-A RECEPTOR 7
    1e-07  35%  2qu6A  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    1e-07  39%  2pv8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-07  36%  1pkgB  [d.144.1] C-KIT PROTEIN
    1e-07  29%  3eknA  [x.x.x] INSULIN RECEPTOR
    1e-07  35%  3eflA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    1e-07  36%  3e92A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-07  36%  3cs9C  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-07  36%  3cs9B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-07  35%  3blrA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    1e-07  35%  3blqA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    1e-07  35%  3be2A  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    1e-07  41%  2ptoA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-07  44%  2hw6B  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    1e-07  29%  3gniB  [x.x.x] STRAD ALPHA
    1e-07  34%  3d83A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-07  29%  3d5xA  [x.x.x] POLO-LIKE KINASE 1
    2e-07  30%  2z8cA  [x.x.x] INSULIN RECEPTOR
    2e-07  31%  1yomB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  32%  2qlqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  31%  2pmlX  [x.x.x] SER/THR PROTEIN KINASE
    2e-07  41%  2npqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-07  36%  1mqbA  [d.144.1] EPHRIN TYPE-A RECEPTOR 2
    2e-07  30%  1ir3A  [d.144.1] INSULIN RECEPTOR
    2e-07  32%  2hwoB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  41%  2fsmX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-07  38%  3fc1X  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-07  32%  3en7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  32%  3en7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  32%  3en6B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  32%  3d7uD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  32%  3d7uB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  30%  3bu5A  [x.x.x] INSULIN RECEPTOR SUBUNIT BETA
    2e-07  30%  3bu3A  [d.144.1 (1rqqA)] INSULIN RECEPTOR SUBUNIT BETA
    2e-07  30%  2auhA  [x.x.x] INSULIN RECEPTOR
    2e-07  40%  2wo6B  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    2e-07  40%  2wo6A  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    2e-07  40%  2vx3D  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    2e-07  40%  2vx3C  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    2e-07  40%  2vx3B  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    2e-07  40%  2vx3A  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    2e-07  32%  2qo7A  [x.x.x] EPHRIN RECEPTOR
    2e-07  32%  2qo2A  [x.x.x] EPHRIN RECEPTOR
    2e-07  40%  1kwpB  [d.144.1] MAP KINASE ACTIVATED PROTEIN KINASE 2
    2e-07  36%  3fmeA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    2e-07  40%  3dkoA  [x.x.x] EPHRIN TYPE-A RECEPTOR 7
    3e-07  26%  2ijmB  [x.x.x] FOCAL ADHESION KINASE 1
    3e-07  32%  2hwpA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-07  36%  3cjgA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    3e-07  26%  3cd3A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FES/FPS
    3e-07  36%  3brbA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE MER
    4e-07  41%  1zxeA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    4e-07  32%  1vr2A  [d.144.1] PROTEIN (VASCULAR ENDOTHELIAL GROWTH FACTOR
    4e-07  32%  2qoqA  [x.x.x] EPHRIN RECEPTOR
    4e-07  37%  1nxkD  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    4e-07  34%  1mqbB  [d.144.1] EPHRIN TYPE-A RECEPTOR 2
    4e-07  41%  1kv2A  [d.144.1] P38 MAP KINASE
    4e-07  26%  2ijmA  [x.x.x] FOCAL ADHESION KINASE 1
    4e-07  35%  3fbvI  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    4e-07  35%  3fbvD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    4e-07  35%  3fbvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    4e-07  29%  3f82A  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    4e-07  39%  3e93A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-07  32%  3ckwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    4e-07  38%  3bprD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE MER
    4e-07  38%  3bprC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE MER
    4e-07  38%  3bprB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE MER
    4e-07  38%  3bprA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE MER
    4e-07  35%  2b9fA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    4e-07  41%  1a06A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    5e-07  38%  1wfcA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE P38
    5e-07  28%  1u4dA  [d.144.1] ACTIVATED CDC42 KINASE 1
    5e-07  44%  2p3gX  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    5e-07  28%  2jkqA  [x.x.x] FOCAL ADHESION KINASE 1
    5e-07  38%  2gfsA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-07  26%  3bz3A  [x.x.x] FOCAL ADHESION KINASE 1
    7e-07  31%  1yolB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-07  31%  1yolA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-07  34%  1y6bA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    7e-07  34%  1y6aA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    7e-07  34%  2p2iB  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    7e-07  38%  1nxkC  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    7e-07  38%  1nxkA  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    7e-07  27%  2j0jA  [x.x.x] FOCAL ADHESION KINASE 1
    7e-07  31%  1i44A  [d.144.1] INSULIN RECEPTOR
    7e-07  25%  1ckjB  [d.144.1] RECOMBINANT CASEIN KINASE I DELTA
    7e-07  25%  1ckjA  [d.144.1] RECOMBINANT CASEIN KINASE I DELTA
    7e-07  32%  3c7qA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    8e-07  29%  1ywnA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    8e-07  37%  2p0cB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE MER
    8e-07  37%  2p0cA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE MER
    8e-07  36%  1nxkB  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    8e-07  28%  1lufA  [d.144.1] MUSCLE-SPECIFIC TYROSINE KINASE RECEPTOR MUSK
    8e-07  32%  2jbpK  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    8e-07  35%  2f9gA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    8e-07  26%  2etmB  [x.x.x] FOCAL ADHESION KINASE 1
    8e-07  27%  2etmA  [x.x.x] FOCAL ADHESION KINASE 1
    8e-07  22%  1ckiB  [d.144.1] CASEIN KINASE I DELTA
    8e-07  22%  1ckiA  [d.144.1] CASEIN KINASE I DELTA
    8e-07  26%  3cblA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FES/FPS
    8e-07  37%  3brbB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE MER
    8e-07  26%  3bkbA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FES/FPS
    1e-06  32%  2qooA  [x.x.x] EPHRIN RECEPTOR
    1e-06  38%  2pziA  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNG
    1e-06  40%  2fstX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-06  40%  2fsoX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-06  39%  2fslX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-06  38%  2fa2B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-06  38%  2fa2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-06  38%  2f49A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-06  38%  2b9hA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-06  34%  2a1aB  [x.x.x] INTERFERON-INDUCED, DOUBLE-STRANDED RNA-
    1e-06  34%  2a19B  [x.x.x] INTERFERON-INDUCED, DOUBLE-STRANDED RNA-
    1e-06  33%  2qu6B  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    1e-06  32%  2qolA  [x.x.x] EPHRIN RECEPTOR
    1e-06  32%  2qoiA  [x.x.x] EPHRIN RECEPTOR
    1e-06  32%  2qofA  [x.x.x] EPHRIN RECEPTOR
    1e-06  32%  2qodA  [x.x.x] EPHRIN RECEPTOR
    1e-06  28%  2jkmA  [x.x.x] FOCAL ADHESION KINASE 1
    1e-06  37%  2jbpJ  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-06  28%  2j0mB  [x.x.x] FOCAL ADHESION KINASE 1
    1e-06  28%  2j0kA  [x.x.x] FOCAL ADHESION KINASE 1
    1e-06  37%  2hw6A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    1e-06  33%  3dtwA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    1e-06  33%  3cpcA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    1e-06  33%  3cpbA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    1e-06  33%  3b8qA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    2e-06  42%  1zxeF  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    2e-06  30%  2vwvA  [x.x.x] EPHRIN TYPE-B RECEPTOR 4
    2e-06  26%  1u54A  [d.144.1] ACTIVATED CDC42 KINASE 1
    2e-06  35%  2p4iA  [x.x.x] ANGIOPOIETIN-1 RECEPTOR
    2e-06  29%  3efkB  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    2e-06  29%  3efjA  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    2e-06  27%  1u46A  [d.144.1] ACTIVATED CDC42 KINASE 1
    2e-06  36%  2rioB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    2e-06  36%  2rioA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    2e-06  38%  2pziB  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNG
    2e-06  40%  2pv5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  28%  2jkoA  [x.x.x] FOCAL ADHESION KINASE 1
    2e-06  28%  2jkkA  [x.x.x] FOCAL ADHESION KINASE 1
    2e-06  36%  2jc6C  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-06  36%  2jc6A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-06  28%  2j0kB  [x.x.x] FOCAL ADHESION KINASE 1
    2e-06  33%  2ivsB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    3e-06  37%  1sm2A  [d.144.1] TYROSINE-PROTEIN KINASE ITK/TSK
    3e-06  28%  3h9rA  [x.x.x] ACTIVIN RECEPTOR TYPE-1
    3e-06  29%  3ctjA  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    3e-06  29%  3c1xA  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    4e-06  30%  1yojA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-06  34%  2helA  [x.x.x] EPH RECEPTOR A4
    4e-06  36%  3db8A  [x.x.x] POLO-LIKE KINASE 1
    6e-06  30%  1u5qA  [d.144.1] SERINE/THREONINE PROTEIN KINASE TAO2
    6e-06  34%  3d5vA  [x.x.x] POLO-LIKE KINASE 1
    7e-06  41%  1zxeE  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    7e-06  41%  1zxeB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    7e-06  38%  1t4hA  [d.144.1] SERINE/THREONINE-PROTEIN KINASE WNK1
    7e-06  32%  1jpaB  [d.144.1] NEURAL KINASE, NUK=EPH/ELK/ECK FAMILY RECEPTOR-
    7e-06  30%  1jpaA  [d.144.1] NEURAL KINASE, NUK=EPH/ELK/ECK FAMILY RECEPTOR-
    7e-06  32%  2hwpB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-06  38%  3fpqB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE WNK1
    7e-06  38%  3fpqA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE WNK1
    7e-06  27%  3eqrB  [x.x.x] ACTIVATED CDC42 KINASE 1
    7e-06  31%  3en6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-06  31%  3en5A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-06  26%  1u54B  [d.144.1] ACTIVATED CDC42 KINASE 1
    9e-06  26%  1u4dB  [d.144.1] ACTIVATED CDC42 KINASE 1
    9e-06  26%  1u46B  [d.144.1] ACTIVATED CDC42 KINASE 1
    9e-06  31%  1p14A  [d.144.1] INSULIN RECEPTOR
    9e-06  30%  2henA  [x.x.x] EPHRIN TYPE-B RECEPTOR 2
    9e-06  34%  1fvrB  [d.144.1] TYROSINE-PROTEIN KINASE TIE-2
    9e-06  33%  1fvrA  [d.144.1] TYROSINE-PROTEIN KINASE TIE-2
    9e-06  26%  3eqrA  [x.x.x] ACTIVATED CDC42 KINASE 1
    9e-06  26%  3eqpA  [x.x.x] ACTIVATED CDC42 KINASE 1
    9e-06  26%  3eqpB  [x.x.x] ACTIVATED CDC42 KINASE 1
    1e-05  30%  2vwwA  [x.x.x] EPHRIN TYPE-B RECEPTOR 4
    1e-05  25%  1tkiA  [d.144.1] TITIN
    1e-05  29%  2rfnB  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    1e-05  29%  2rfnA  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    1e-05  35%  2p4iB  [x.x.x] ANGIOPOIETIN-1 RECEPTOR
    1e-05  35%  2oscA  [x.x.x] ANGIOPOIETIN-1 RECEPTOR
    1e-05  35%  2oo8X  [x.x.x] ANGIOPOIETIN-1 RECEPTOR
    1e-05  29%  3efjB  [x.x.x] HEPATOCYTE GROWTH FACTOR RECEPTOR
    2e-05  31%  3cc6A  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    2e-05  36%  1sm2B  [d.144.1] TYROSINE-PROTEIN KINASE ITK/TSK
    2e-05  36%  3enmB  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    3e-05  29%  3fzoA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    3e-05  32%  3et7A  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    3e-05  36%  3enmC  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    4e-05  30%  3ekkA  [x.x.x] INSULIN RECEPTOR
    5e-05  33%  1z57A  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE CLK1
    5e-05  22%  1kobA  [d.144.1] TWITCHIN
    6e-05  33%  3h3cA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    6e-05  32%  3fzsA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    6e-05  33%  2exeA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE CLK3
    6e-05  26%  3e3bX  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA'
    8e-05  31%  3fzpA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    8e-05  28%  3bw5A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  26%  1zohA  [x.x.x] PROTEIN KINASE CK2, ALPHA SUBUNIT
    1e-04  26%  2qc6A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  26%  2pvkA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  26%  2pvjA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  26%  1om1A  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    1e-04  27%  1mp8A  [d.144.1] FOCAL ADHESION KINASE 1
    1e-04  26%  1lp4A  [d.144.1] PROTEIN KINASE CK2
    1e-04  31%  3fztA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    1e-04  26%  3fl5A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  26%  1f0qA  [d.144.1] PROTEIN KINASE CK2, ALPHA SUBUNIT
    1e-04  26%  1ds5A  [d.144.1] CASEIN KINASE, ALPHA CHAIN
    1e-04  27%  2zjwA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  27%  2rkpA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  27%  2r7iD  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  27%  2r7iC  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  27%  2r7iB  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  27%  2r7iA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  27%  2pvrA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA, CATALYTIC
    1e-04  27%  1pjkA  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    1e-04  27%  1na7A  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    1e-04  27%  1jwhB  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    1e-04  27%  1jwhA  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    1e-04  27%  3h30A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-04  27%  3bqcA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    2e-04  33%  2eu9A  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE CLK3
    2e-04  31%  3cjfA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    2e-04  35%  2vagA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE CLK1
    2e-04  52%  2qr7A  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-3
    2e-04  36%  3enmD  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    2e-04  36%  3enmA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    3e-04  27%  2jiiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE VRK3 MOLECULE:
    3e-04  27%  2jiiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE VRK3 MOLECULE:
    4e-04  38%  2a19C  [x.x.x] INTERFERON-INDUCED, DOUBLE-STRANDED RNA-
    7e-04  33%  1t53A  [x.x.x] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
:543

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARG
3f69B           ------ALNFSHQNGIIHRDVKPANILISATNAVKVVDFGIARAIADSG--NSVQTIGTAQYLSPEQARG
2fumA           ------ALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIAD----------GTAQYLSPEQARG
2fumB           ------ALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARA------------IGTAQYLSPEQARG
1o6yA           ------ALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIAQ--------------YLSPEQARG
3f69A           ------ALNFSHQNGIIHRDVKPANILISATNAVKVVDFGIARAI-------------TAQYLSPEQARG
2fumD           ------ALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGI---------------IGTAQYLSPEQARG
1mruB           ------ALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAI-------------TAQYLSPEQARG
1mruA           ------ALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAI-------------TAQYLSPEQARG
3f61A           ------ALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIAA-----------------QYLSPEQARG
2fumC           ------ALNFSHQNGIIHRDVKPANIMISATNAVKVMDFA--------------------QYLSPEQARG
2biyA           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAVLSPESKQARANAFVGTAQYVSPELLTE
3hrfA           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTE
2r3qA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2r3iA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1gz8A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1uwhA           --QTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVLS-----------GSILWMAPEVIRK
3d4qA           --QTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVLS-----------GSILWMAPEVIRK
1vzoA           VGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERAYDFCGTIEYMAPDIVRG
3idpA           --QTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLAT--------------GSILWMAPEVIRQ
2h9vA           --EVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEKSQG
2fb8A           --QTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLA------------TVSGSILWMAPEVIRK
2f2uB           --EVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEKSQG
2f2uA           --EVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEKSQG
2c30A           ---VLQALAYLHAQGVIHRDIKSDSILLTLDGRVKLSDFGFCAQISKD--VPKRKLVGTPYWMAPEVISR
1uwjA           --QTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLA-----------TEKSGSILWMAPEVIRK
1uu7A           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKV-----LSPRANFVGTAQYVSPELLTE
1ykrA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2wipC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2wipA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1vywC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1vywA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2vtrA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1uwjB           --QTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLA------------TEKGSILWMAPEVIRK
2r3hA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2qnjB           --QIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEF-----TKLDTFCGSPPYAAPELFQG
1okvC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1okvA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1oirA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1jsvA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1hckA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1h0uA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1h01A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
3f5xA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1f5qC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1f5qA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
3eocC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
3ej1C           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
3ej1A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1e1vA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2ds1A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2clxA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2c6iA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2c68A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2c5yA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2c4gC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2c4gA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1buhA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2bkzC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
2a4lA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV-TLWYRAPEILLG
1zrzA           --EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPG--DTTSFCGTPNYIAPEILRG
1okyA           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPA------NFVGTAQYVSPELLTE
3hrcA           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPARA----NFVGTAQYVSPELLTE
3h9oA           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTA---------KVLSFVGTAQYVSPELLTE
1h1wA           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPARA----NFVGTAQYVSPELLTE
1uu8A           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVL--------SNFVGTAQYVSPELLTE
2qnjA           --QIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEF-------TDTFCGSPPYAAPELFQG
3h4jA           --QIICAIEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTS--CGSPNYAAPEVING
3h4jB           --QIICAIEYCHRHKIVHRDLKPENLLLDDNLNVKIADFGLSNIMTDGNFLKTS--CGSPNYAAPEVING
1fotA           --EVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY-----LCGTPDYIAPEVVST
2v55C           --EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEKSQG
2v55A           --EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEKSQG
3idpB           --QTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLS---------------GSILWMAPEVIRK
2etkB           --EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEKSQG
2etkA           --EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEKSQG
1uu9A           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTA---------KVLNFVGTAQYVSPELLTE
1okzA           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTA---------KVLNFVGTAQYVSPELLTE
2hakE           --QIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEF--TVGNKLDTFCGSPPYAAPELFQG
3eidC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHVTL---WYRAPEILLG
3c51B           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c51A           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c50B           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c50A           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c4zA           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c4yB           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c4yA           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c4xB           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c4xA           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c4wB           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
3c4wA           --QIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVEL-KAGQTKTKGYAGTPGFMAPELLLG
2z7sA           LAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGL-------------SKEGTVEYMAPEVVNR
2z7rA           LAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGL-------------SKEGTVEYMAPEVVNR
2z7qA           LAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGL-------------SKEGTVEYMAPEVVNR
1z5mA           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVL----------FVGTAQYVSPELLTE
1uu3A           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVL----------FVGTAQYVSPELLTE
2r7bA           --EIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVL----------FVGTAQYVSPELLTE
2q0nA           ---VLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKE--VPRRKLVGTPYWMAPELISR
2j0iA           ---VLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKE--VPRRKLVGTPYWMAPELISR
2g9xC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
3eidA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYT---VVTLWYRAPEILLG
2cdzA           ---VLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKE--VPRRKLVGTPYWMAPELISR
2vd5B           LAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSCLKLRADGTVRSLVAVGTPDYLSPEQAVG
2uztA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFG----FAKRVKGRTWTLCGTPEYLAPEIILS
3fe3A           --QIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEF--TVGGKLDAFCGAPPYAAPELFQG
3eqiA           ---------------IMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS---MANSFVGTRSYMSPERLQG
3eqfA           ---------------IMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS---MANSFVGTRSYMSPERLQG
1y91A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGYTHEVVT------LWYRAPEILLG
3dbqA           ---MLEAVHTIHQHGIVHSDLKPANFLIV-DGMLKLIDFGIA-----------NQMVGTVNYMPPEAIKD
2bvaB           ---VLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFG----FCAQVEVPRRKLVGTPYWMAPELISR
2bvaA           ---VLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFG----FCAQVEVPRRKLVGTPYWMAPELISR
2zmcA           ---MLEAVHTIHQHGIVHSDLKPANFLIV-DGMLKLIDFGIA--------NQMDSQVGTVNYMPPEAIKD
1w98A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1vyzA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGE---------VVTLWYRAPEILLG
1oiyA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1oiuC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1oi9A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1oguC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1oguA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1jsuA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1jstA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2jgzA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2iw9C           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2iw9A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2iw8C           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2iw8A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2iw6C           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2iw6A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1h27C           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1h26C           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1h25C           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1h24A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
1h0vA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTE----VVTLWYRAPEILLG
1h08A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGHEVVT--------LWYRAPEILLG
2g9xA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
3fz1A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGHEVVT--------LWYRAPEILLG
2f7xE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFG----FAKRVKGRTWTLCGTPEYLAPEIILS
1e9hA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
3dogC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
3dogA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
3ddqC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
3ddqA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2cjmC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2cjmA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2cchA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
3bhuC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
3bhtC           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
3bhtA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVP--VRTYHEVVTLWYRAPEILLG
2i40A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFG----VPVRTYVVTLWYRAPEILLG
2vtsA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFHE---------VVTLWYRAPEILLG
2vtoA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFHE---------VVTLWYRAPEILLG
2j4zB           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV---HAPSSRRTTLCGTLDYLPPEMIEG
2j4zA           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV---HAPSSRRTTLCGTLDYLPPEMIEG
2hakA           --QIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFT----------VGSPPYAAPELFQG
3c4cA           --QTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFG----------------SGSILWMAPEVIRS
2vtiA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFVVT-----------LWYRAPEILLG
2uznA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFVVT-----------LWYRAPEILLG
1jvpP           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFVVT-----------LWYRAPEILLG
2iwiB           -GQVVAAIQHCHSRGVVHRDIKDENILILRRGCAKLIDFGSGALLHDEPYTDFD---GTRVYSPPEWSRH
2iwiA           -GQVVAAIQHCHSRGVVHRDIKDENILILRRGCAKLIDFGSGALLHDEPYTDFD---GTRVYSPPEWSRH
1fvtA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVVTL----------WYRAPEILLG
2w06A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFEVVTL----------WYRAPEILLG
2vtpA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFEVVTL----------WYRAPEILLG
2vrxB           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSV----HAPSLRRRMCGTLDYLPPEMIEG
2vgpB           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSV----HAPSLRRRMCGTLDYLPPEMIEG
2vgpA           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSV----HAPSLRRRMCGTLDYLPPEMIEG
2vgoB           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSV----HAPSLRRRMCGTLDYLPPEMIEG
2vgoA           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSV----HAPSLRRRMCGTLDYLPPEMIEG
1v0oB           --QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIPVRKYTHEVV-TLWYRAPDVLMG
1v0oA           --QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIPVRKYTHEVV-TLWYRAPDVLMG
1v0bA           --QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIPVRKYTHEVV-TLWYRAPDVLMG
1mq4A           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV-----HAPSSRTLCGTLDYLPPEMIEG
3h10B           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV---HAPSSRRAALCGTLDYLPPEMIEG
3h10A           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV---HAPSSRRAALCGTLDYLPPEMIEG
2fvdA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGL--AFGVPVRTYTHEVV-TLWYRAPEILLG
2f57B           ---VLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKE--VPKRKLVGTPYWMAPEVISR
2f57A           ---VLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKE--VPKRKLVGTPYWMAPEVISR
3e5aA           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRT----LCGTLDYLPPEMIEG
1di8A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFEVVTL----------WYRAPEILLG
2bfyB           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSV----HAPSLRRRMCGTLDYLPPEMIEG
2bfyA           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSV----HAPSLRRRMCGTLDYLPPEMIEG
2bfxB           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSV----HAPSLRRRMCGTLDYLPPEMIEG
2bfxA           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSV----HAPSLRRRMCGTLDYLPPEMIEG
2acxB           --EICCGLEDLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIK--GRVGTVGYMAPEVVKN
2acxA           --EICCGLEDLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIK--GRVGTVGYMAPEVVKN
2weiA           --QVFSGITYMHKHNIVHRDLKPENILLEKDCDIKIIDFGLSTCFQQN--TKMKDRIGTAYYIAPEVLRG
2w7xA           --QMLLAVQYLHENGIIHRDLKPENVLLSEDCLIKITDFGHSKILGETSLMRT--LCGTPTYLAPEGTAG
1j3hB           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA------KRVKGRTWLGTPEYLAPEIILS
1j3hA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA------KRVKGRTWLGTPEYLAPEIILS
3gfwA           ---MLEAVHTIHQHGIVHSDLKPANFLIV-DGMLKLIDFGIA---------------GTVNYMPPEAIKD
2cn5A           --QMLLAVQYLHENGIIHRDLKPENVLLSEDCLIKITDFGHSKILGETSLMRT--LCGTPTYLAPEGTAG
1wccA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFV------------TLWYRAPEILLG
2vthA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFV------------TLWYRAPEILLG
2r5tA           --EIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNST-TSTFCGTPEYLAPEVLHK
1ol7A           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV-----HAPSSRRLCGTLDYLPPEMIEG
1ol5A           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV-----HAPSSRRLCGTLDYLPPEMIEG
1ke6A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFV------------TLWYRAPEILLG
3hdnA           --EIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNST-TSTFCGTPEYLAPEVLHK
3hdmA           --EIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNST-TSTFCGTPEYLAPEVLHK
3ha6A           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV-----HAPSSRRLCGTLDYLPPEMIEG
1giiA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFV------------TLWYRAPEILLG
3fxzA           --ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI--TPEQSKRSMVGTPYWMAPEVVTR
1ckpA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFV------------TLWYRAPEILLG
1yhwA           --ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQ-SKRSTMVGTPYWMAPEVVTR
3ig7A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAF-------------TLWYRAPEILLG
3c4cB           --QTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFS-----------------GSILWMAPEVIRS
2bdwB           --QILESIAYCHSNGIVHRNLKPENLLLAKGAAVKLADFGLAIEVNDSE--AWHGFAGTPGYLSPEVLKK
2bdwA           --QILESIAYCHSNGIVHRNLKPENLLLAKGAAVKLADFGLAIEVNDSE--AWHGFAGTPGYLSPEVLKK
1zysA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
1yhvA           --ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQ-SKRSEMVGTPYWMAPEVVTR
1xh9A           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGLA-----KRVKGRTWLCGTPEYLAPEIILS
2wmxA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2wmwA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2wmvA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2wmuA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2wmtA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2wmsA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2wmrA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2wmqA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2r0uA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2qhnA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2ozaA           ------AIQYLHSINIAHRDVKPENLLYTPNAILKLTDFGFAKE--TTSHNSLTTPCYTPYYVAPEVLGP
1nvrA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
3jvsA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
3jvrA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
1ia8A           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2hogA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
1h0wA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAF---------GVPVTLWYRAPEILLG
2gdoA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
3f9nA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2e9nA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
3dxnA           MKQVLSGTTYLHKHNIVHRDLKPENLLLKSDALIKIVDFGLSAHF---------ERLGTAYYIAPEVLR-
2cgxA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2cgwA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2cgvA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2cguA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2c3lA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2c3kA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2c3jA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2brnA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2brmA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2brhA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2brgA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2aypA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLNKMCGTLPYVAPELLKR
2zmdA           ---MLEAVHTIHQHGIVHSDLKPANFLIV-DGMLKLIDFGIA--------NQMDSQVGAVNYMPPEAIK-
1f3mC           --ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFC--------AQITTMVGTPYWMAPEVVTR
1ydrE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2vu3A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGFGVPVR----TYTHEVV-TLWYRAPEILLG
2vo6A           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2vo0A           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1v0bB           --QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGVT-----------LWYRAPDVLMG
2uw4A           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2uvzA           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2uvyA           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2uvxA           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1szmB           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1szmA           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1s9jA           ---------------IMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRS------YMSPERLQG
2r3nA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLVV---------------TLWYRAPEILLG
2qluA           -----------HKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPDTHGQVGTRRYMAPEVLEG
1q61A           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2jdtA           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1h07A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGL----ARPVRTYTHEVV-TLWYRAPEILLG
2fh9A           --QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGL--NFLKTS-------CGSPNYAAPEVISG
3eqcA           ---------------IMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRS------YMSPERLQG
3e8nA           ---------------IMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS---MANSV-GTRSYMSPERLQG
3dv3A           ---------------IMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANGTRS------YMSPERLQG
3dneA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3dndA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3d2iA           ------ALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSV----------HAPCGTLDYLPPEMIEG
1cmkE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1cdkA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2w17A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLAVV--------------TLWYRAPEILLG
2vv9A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLAVV--------------TLWYRAPEILLG
1s9iA           ---------------IMHRDVKPSNILVNSRGEIKLCDFGVSGQLID-------SMVGTRSYMAPERLQG
2r3lA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLA----------------TLWYRAPEILLG
2r3kA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLA-------------RVVTLWYRAPEILLG
2qkwB           -----------HTRAIIHRDVKSINILLDENFVPKITDFGISK--KGTELDQTHLVVGTLGYIDPEYFIK
1ob3A           --QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIVTL----------WYRAPDVLMG
1o6lA           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM--KFCGTPEYLAPEVLED
1o6kA           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM--KFCGTPEYLAPEVLED
2nryC           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARA----SQTVMSRIVGTTAYMAPEALRG
2jdoA           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM--KFCGTPEYLAPEVLED
3e8dB           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM--KFCGTPEYLAPEVLED
3e8dA           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM--KFCGTPEYLAPEVLED
3e88A           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM--KFCGTPEYLAPEVLED
3e87A           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM--KFCGTPEYLAPEVLED
3dy7A           ---------------IMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANGTRS------YMSPERLQG
3d15A           ------ALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSV----------HAPSGTLDYLPPEMIEG
3d0eA           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM--KFCGTPEYLAPEVLED
1xo2B           MFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSQMALT---SVVVTLWYRAPEVLLQ
1xh8A           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1xh7A           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1xh6A           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1u7eA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLAGTPEYLAPEIILS
1stcE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1smhA           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIQVTDFGLA-----KRVKGRTWLCGTPEYLAPEIILS
1rejA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2r3jA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLA------------REVVTLWYRAPEILLG
2qvsE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2qurA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2qcsA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1qcfA           --QIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINF
1q8wA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1q8uA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1q8tA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1pmqA           --QMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARSFMMTPYVVTR------YYRAPEVILG
1p2aA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLAV---------------TLWYRAPEILLG
2oicD           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARA----SEAQVMRIVGTTAYMAPEALRG
2oibD           -----------HENHHIHRDIKSANILLDEAFTAKISDFGL--ARASEKFAQVMRIVGTTAYMAPEALRG
1muoA           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGW-------------SLCGTLDYLPPEMIEG
1l3rE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1jowB           MFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSQMALT---SVVVTLWYRAPEVLLQ
1jbpE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3idbA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3hztA           MKQVLSGTTYLHKHNIVHRDLKPENLLLSRDALIKIVDFGLSAHFE----------VGTAYYIAPEVLR-
2hk5A           --QIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINF
3hgkC           -----------HTRAIIHRDVKSINILLDENFVPKITDFGISK--KGTELGQTHLVVGTLGYIDPEYFIK
3hgkB           -----------HTRAIIHRDVKSINILLDENFVPKITDFGISK--KGTELGQTHLVVGTLGYIDPEYFIK
3hgkA           -----------HTRAIIHRDVKSINILLDENFVPKITDFGISK--KGTELGQTHLVVGTLGYIDPEYFIK
2h34A           -----------------HRDVKPENILVSADDFAYLVDFGI----------------GTLYY-APERF--
1h00A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAEVVT-----------LWYRAPEILLG
2gu8A           --QIVLTFEYLHSLDLIYRDLKPENLLIDEQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1gijA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLAV---------------TLWYRAPEILLG
1gihA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLAV---------------TLWYRAPEILLG
1g3nA           MFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSQMALT---SVVVTLWYRAPEVLLQ
1fmoE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3fjqE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3fhiA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLAGTPEYLAPEIILS
2f2cB           MFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSQMALT---SVVVTLWYRAPEVLLQ
2eufB           MFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSQMALT---SVVVTLWYRAPEVLLQ
3e8eI           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3e8cE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3e8cB           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3dakD           --EVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVS-AFLATGGDITRNFVGTPCWMAPEQVRG
1ctpE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2cpkE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2c1aA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3bwjA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1blxA           MFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSQMALT---SVVVTLWYRAPEVLLQ
1bkxA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1bi8A           MFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSQMALT---SVVVTLWYRAPEVLLQ
1bi7A           MFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSQMALT---SVVVTLWYRAPEVLLQ
1apmE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2yzaA           --QILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGL-------------SNMMSDNYAAPEVISG
2w1eA           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV--------------GTLDYLPPEMIEG
2vwiC           --EVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVS-AFLATGGDITRNKVGTPCWMAPEQVRG
1urwA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAVV------------TLWYRAPEILLG
1oitA           --QLLQGLSFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAVV------------TLWYRAPEILLG
2nruB           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARAFAQTVM----RIVGTTAYMAPEALRG
2nruA           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARAFAQTVM----RIVGTTAYMAPEALRG
3hmmA           -----LHMEIVGTQGIAHRDLKSKNILVKKNGTCCIADLGLAV--RHDSATDTIDIAGTKRYMAPEVLDD
2gnlA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2gnjA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2gngA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2gnfA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3fdnA           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV-----------HACGTLDYLPPEMIEG
3dj5A           ------ALSYCHSKRVIHRDIKPENLLLGSNGELKIADFG------------WTTLCGTLDYLPPEMIEG
3bhhD           --QILEAVLHCHQMGVVHRDLKPENLLLAKGAAVKLADFGLAIE-VQGDQQAWFGFAGTPGYLSPEVLRK
3bhhC           --QILEAVLHCHQMGVVHRDLKPENLLLAKGAAVKLADFGLAIE-VQGDQQAWFGFAGTPGYLSPEVLRK
3bhhB           --QILEAVLHCHQMGVVHRDLKPENLLLAKGAAVKLADFGLAIE-VQGDQQAWFGFAGTPGYLSPEVLRK
3bhhA           --QILEAVLHCHQMGVVHRDLKPENLLLAKGAAVKLADFGLAIE-VQGDQQAWFGFAGTPGYLSPEVLRK
2welA           --QILESVNHCHLNGIVHRDLKPENLLLSKGAAVKLADFGLAIE-VQGDQQAWFGFAGTPGYLSPEVLRK
2w1gA           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV------------HAGTLDYLPPEMIEG
2w1fA           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH-------------GTLDYLPPEMIEG
2vn9A           --QILESVNHCHLNGIVHRDLKPENLLLSKGAAVKLADFGLAIE-VQGDQQAWFGFAGTPGYLSPEVLRK
1q62A           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1q24A           --QIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3i79A           --QVLSGITYMHKNKIVHRDLKPENLLLSKDANIRIIDFGLSTHFEASK--KMKDKIGTAYYIAPEVLHG
3hx4A           --QVLSGITYMHKNKIVHRDLKPENLLLSKDANIRIIDFGLSTHFEASK--KMKDKIGTAYYIAPEVLHG
2hakD           --QIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGF-----------SNEFTVGPPYAAPELFQG
2hakC           --QIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGF-----------SNEFTVGPPYAAPELFQG
3dj7A           ------ALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPS---------CGTLDYLPPEMIEG
3d14A           ------ALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPS---------CGTLDYLPPEMIEG
2c6dA           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH-------------GTLDYLPPEMIEG
2vz6B           --QILEAVLHCHQMGVVHRDLKPENLLLAKGAAVKLADFGLAIE-VEGEQQAWFGFAGTPGYLSPEVLRK
2vz6A           --QILEAVLHCHQMGVVHRDLKPENLLLAKGAAVKLADFGLAIE-VEGEQQAWFGFAGTPGYLSPEVLRK
1sykB           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
1sykA           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
2qg5D           MKDVLSAVAYCHKLNVAHRDLKPENFLFSPDSPLKLIDFGLAARFKPGKMMRTK--VGTPYYVSPQVLEG
2qg5B           MKDVLSAVAYCHKLNVAHRDLKPENFLFSPDSPLKLIDFGLAARFKPGKMMRTK--VGTPYYVSPQVLEG
2qg5A           MKDVLSAVAYCHKLNVAHRDLKPENFLFSPDSPLKLIDFGLAARFKPGKMMRTK--VGTPYYVSPQVLEG
2oibC           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARA------AQVMRIVGTTAYMAPEALRG
3faaA           -----LHMEIVGTQGIAHRDLKSKNILVKKNGTCCIADLGLAVRHSATDTIDINHRVGTKRYMAPEVLDD
3f3zA           MKDVLSAVAYCHKLNVAHRDLKPENFLFSPDSPLKLIDFGLAARFKPGKMMRTK--VGTPYYVSPQVLEG
3c0iA           MRQILEALRYCHDNNIIHRDVKPHCVLLASSAPVKLGGFGVAIQLGESGLV-AGGRVGTPHFMAPEVVKR
3c0hA           MRQILEALRYCHDNNIIHRDVKPHCVLLASSAPVKLGGFGVAIQLGESGLV-AGGRVGTPHFMAPEVVKR
3c0gB           MRQILEALRYCHDNNIIHRDVKPHCVLLASSAPVKLGGFGVAIQLGESGLV-AGGRVGTPHFMAPEVVKR
3c0gA           MRQILEALRYCHDNNIIHRDVKPHCVLLASSAPVKLGGFGVAIQLGESGLV-AGGRVGTPHFMAPEVVKR
2w05A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLEVV--------------TLWYRAPEILLG
1ob3B           --QLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAF--------------LWYRAPDVLMG
2nryA           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARA-----STVMSRIVGTTAYMAPEALRG
2np8A           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV-HAPSSRT--------LDYLPPEMIEG
1g5sA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLVV---------------TLWYRAPEILLG
3ezvA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLVV---------------TLWYRAPEILLG
1aq1A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLEVV--------------TLWYRAPEILLG
1zycA           --QILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNIGTAMYVATEVLDGTGHY--------
2vd5A           LAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQA
1v1kA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLA-------------RVVTLWYRAPEILLG
2pmiC           --QLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFG-IPVNTFSSEVVTLWYRAPDVLMG
2pmiA           --QLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFG-IPVNTFSSEVVTLWYRAPDVLMG
2pk9C           --QLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFG-IPVNTFSSEVVTLWYRAPDVLMG
2pk9A           --QLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFG-IPVNTFSSEVVTLWYRAPDVLMG
2oidD           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARA-----SEQVMRIVGTTAYMAPEALRG
2oidA           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARA------SEVMRIVGTTAYMAPEALRG
2oibB           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARA------SEVMRIVGTTAYMAPEALRG
2oibA           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARA------SEVMRIVGTTAYMAPEALRG
2j50A           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV-----------TLCGTLDYLPPEMIED
3h9fA           ---MLEAVHTIHQHGIVHSDLKPANFLIV-DGMLKLIDFGIA-----------NQMQGTVNYMPPEAIKD
3h10D           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPST-----------LDYLPPEMIEG
2btrA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLAEVV-------------TLWYRAPEILLG
1zycB           --QILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNVGTAMYVATEVLDGTGHY--------
2w5bA           MTQLTLALKECHRRSL-HRDLKPANVFLDGKQNVKLGDFGLAILNHDTSFAK--AFVGTPYYMSPEQMNR
2vtjA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARV--------------TLWYRAPEILLG
3fpmA           ------AIQYLHSINIAHRDVKPENLLYTPNAILKLTDFGFA---KETTSTP--------YYVAPEVLGP
3e7oA           --QMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLA-RTASTNFMMTPYVV-TRYYRAPEVILG
2duvA           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARV--------------TLWYRAPEILLG
2c6eA           ------ALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWS---------------GTLDYLPPEMIEG
2b52A           --QLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLA------------HEVVTLWYRAPEILLG
1zy4A           --QILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNVHRAMYVATEVLDGTGHY--------
1ym7D           --EIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF---SKKKPHASVGTHGYMAPELQKG
1ym7C           --EIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF---SKKKPHASVGTHGYMAPELQKG
1ym7A           --EIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF---SKKKPHASVGTHGYMAPELQKG
1y57A           --QIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALY
2srcA           --QIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALY
2r0iA           --QIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADF------------------GSPPYAAPELFQG
1omwA           --EIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF---SKKKPHASVGTHGYMAPELQKG
2nryD           -----------HENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMS-----RIVGTTAYMAPEALRG
1mryA           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLC--------------CGTPEYLAPEVLED
1kswA           --QIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALY
2h8hA           --QIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALY
3cikA           --EIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF---SKKKPHASVGTHGYMAPELQKG
3cekA           ---MLEAVHTIHQHGIVHSDLKPANFLIV-DGMLKLIDFGIA-------------NQGTVNYMPPEAIKD
2bcjA           --EIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF---SKKKPHASVGTHGYMAPELQKG
1zydB           --QILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAIGTA--MYVATEVLDGTGHY--------
1zycD           --QILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLA-----------KNVIGTAMYVATEVLDG
1zycC           --QILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLA-----------KNVIGTAMYVATEVLDG
2wouA           -----LHME