[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55245.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2qcxB.bssp"
#ERROR : Can't open dsspfile "2qcxA.bssp"
#ERROR : Can't open dsspfile "1yafC.bssp"
#ERROR : Can't open dsspfile "1yafA.bssp"
#ERROR : Can't open dsspfile "1yakC.bssp"
#ERROR : Can't open dsspfile "1tyhA.bssp"
#ERROR : Can't open dsspfile "1to9B.bssp"
#ERROR : Can't open dsspfile "1to9A.bssp"
#ERROR : Can't open dsspfile "2rd3D.bssp"
#ERROR : Can't open dsspfile "2rd3A.bssp"
#ERROR : Can't open dsspfile "2gm8C.bssp"
#ERROR : Can't open dsspfile "2gm8B.bssp"
#ERROR : Can't open dsspfile "2gm8A.bssp"
#ERROR : Can't open dsspfile "2gm7D.bssp"
#ERROR : Can't open dsspfile "2gm7A.bssp"
#ERROR : Can't open dsspfile "1uddB.bssp"
#ERROR : Can't open dsspfile "1uddA.bssp"
#ERROR : Can't open dsspfile "1z72A.bssp"
#ERROR : Can't open dsspfile "1z72B.bssp"
#ERROR : Can't open dsspfile "2a6bA.bssp"
#ERROR : Can't open dsspfile "2qzcB.bssp"
#ERROR : Can't open dsspfile "2qzcA.bssp"
#ERROR : Can't open dsspfile "1z6uA.bssp"
#ERROR : Can't open dsspfile "2a2oD.bssp"
#ERROR : Can't open dsspfile "2a2oA.bssp"
#ERROR : Can't open dsspfile "2a2mA.bssp"

## Summary of PDB Search
:230
    1e-34  32%  2qcxB  [x.x.x] TRANSCRIPTIONAL ACTIVATOR TENA
    1e-34  32%  2qcxA  [x.x.x] TRANSCRIPTIONAL ACTIVATOR TENA
    2e-34  32%  1yafC  [x.x.x] TRANSCRIPTIONAL ACTIVATOR TENA
    2e-34  32%  1yafA  [x.x.x] TRANSCRIPTIONAL ACTIVATOR TENA
    2e-34  32%  1yakC  [x.x.x] TRANSCRIPTIONAL ACTIVATOR TENA
    5e-27  33%  1tyhA  [a.132.1] TRANSCRIPTIONAL ACTIVATOR TENA
    7e-27  34%  1to9B  [a.132.1] THI-4 PROTEIN
    9e-27  33%  1to9A  [a.132.1] THI-4 PROTEIN
    3e-21  24%  2rd3D  [x.x.x] TRANSCRIPTIONAL REGULATOR
    3e-21  24%  2rd3A  [x.x.x] TRANSCRIPTIONAL REGULATOR
    4e-19  27%  2gm8C  [x.x.x] TENA HOMOLOG/THI-4 THIAMINASE
    4e-19  27%  2gm8B  [x.x.x] TENA HOMOLOG/THI-4 THIAMINASE
    4e-19  27%  2gm8A  [x.x.x] TENA HOMOLOG/THI-4 THIAMINASE
    4e-19  27%  2gm7D  [x.x.x] TENA HOMOLOG/THI-4 THIAMINASE
    4e-19  27%  2gm7A  [x.x.x] TENA HOMOLOG/THI-4 THIAMINASE
    4e-14  24%  1uddB  [a.132.1] TRANSCRIPTIONAL REGULATOR
    4e-14  24%  1uddA  [a.132.1] TRANSCRIPTIONAL REGULATOR
    2e-11  27%  1z72A  [x.x.x] TRANSCRIPTIONAL REGULATOR, PUTATIVE
    2e-10  28%  1z72B  [x.x.x] TRANSCRIPTIONAL REGULATOR, PUTATIVE
    2e-10  28%  2a6bA  [x.x.x] HYPOTHETICAL PROTEIN SPR0628
    5e-10  28%  2qzcB  [x.x.x] TRANSCRIPTIONAL ACTIVATOR TENA-1
    1e-09  29%  2qzcA  [x.x.x] TRANSCRIPTIONAL ACTIVATOR TENA-1
    2e-04  28%  1z6uA  [x.x.x] NP95-LIKE RING FINGER PROTEIN ISOFORM B
    2e-04  25%  2a2oD  [x.x.x] HYPOTHETICAL PROTEIN BT3146
    2e-04  25%  2a2oA  [x.x.x] HYPOTHETICAL PROTEIN BT3146
    2e-04  25%  2a2mA  [x.x.x] HYPOTHETICAL PROTEIN BT3146
:230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLADKTSNQEMKRL
2qcxB           MKFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGR
2qcxA           MKFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGR
1yafC           -KFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGR
1yafA           -KFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGR
1yakC           --FSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGR
1tyhA           LKFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGR
1to9B           -KFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTG-
1to9A           -KFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGR
2rd3D           MQVSQYLYQNAQSIWGDCISHPFVQGIGRGTLERDKFRFYIIQDYLFLLEYAKVFALGVVKACDEAVMRE
2rd3A           MQVSQYLYQNAQSIWGDCISHPFVQGIGRGTLERDKFRFYIIQDYLFLLEYAKVFALGVVKACDEAVMRE
2gm8C           --------ELRRRAWQRILAHPFVAELYAGTLPMEKFKYYLLQDYNYLVNFAKALSLAASRAPSVDLMKT
2gm8B           --------ELRRRAWQRILAHPFVAELYAGTLPMEKFKYYLLQDYNYLVNFAKALSLAASRAPSVDLMKT
2gm8A           --------ELRRRAWQRILAHPFVAELYAGTLPMEKFKYYLLQDYNYLVNFAKALSLAASRAPSVDLMKT
2gm7D           --------ELRRRAWQRILAHPFVAELYAGTLPMEKFKYYLLQDYNYLVNFAKALSLAASRAPSVDLMKT
2gm7A           --------ELRRRAWQRILAHPFVAELYAGTLPMEKFKYYLLQDYNYLVNFAKALSLAASRAPSVDLMKT
1uddB           ---TDKLRRDSEQIWKKIFEHPFVVQLYSGTLPLEKFKFYVLQDFNYLVGLTRALAVISSKAEYPLMAEL
1uddA           ---TDKLRRDSEQIWKKIFEHPFVVQLYSGTLPLEKFKFYVLQDFNYLVGLTRALAVISSKAEYPLMAEL
1z72A           -------LKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSLGACVAHADKLESKLRF
1z72B           -------LKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSLGACVAHADKLESKLRF
2a6bA           -------LKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSLGACVAHADKLESKLRF
2qzcB           --------------WNKYVKHEFILK-RDGSLPLDIFRYYLIQDGKYVEDLRALL-IASSKGPIDKVTKI
2qzcA           --------------WNKYVKHEFILK-RDGSLPLDIFRYYLIQDGKYVEDLRALL-IASSKGPIDKVTKI
1z6uA           -------------------------------------------------------HLIREDCQNQ---KL
2a2oD           -----------------------------GTLDPNAYGS-LVQDGYYCFRGRDDYATAATCAQDETLREF
2a2oA           -----------------------------GTLDPNAYGS-LVQDGYYCFRGRDDYATAATCAQDETLREF
2a2mA           -----------------------------GTLDPNAYGS-LVQDGYYCFRGRDDYATAATCAQDETLREF


                         .         .         *         .         .         .         .:140
query           LKQNAQGLVEGELFIRQQFFKELEISDQEMEQHPIAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYH
2qcxB           MASHAQGTYEAEMALHRXXXXXXXXXXXXRKAFKPSPTAYSFTSHMYRSVLSGNFAEILAALLPCYWLYY
2qcxA           MASHAQGTYEAEMALHRXXXXXXXXXXXXRKAFKPSPTAYSFTSHMYRSVLSGNFAEILAALLPCYWLYY
1yafC           MASHAQGTYEAEMALHRXXXXXXXXXXXXRKAFKPSPTAYSYTSHMYRSVLSGNFAEILAALLPCYWLYY
1yafA           MASHAQGTYEAEMALHRXXXXXXXXXXXXRKAFKPSPTAYSYTSHMYRSVLSGNFAEILAALLPCYWLYY
1yakC           MASHAQGTYEAEMALHRXXXXXXXXXXXXRKAFKPSPTAYSYTSHMYRSVLSGNFAEILAALLPCYWLYY
1tyhA           AS-HAQGTYEAEALHRXXXXXXXXXXXXRKAFKP-SPTAYSYTSH-YRSVLSGNFAEILAALLPCYWLYY
1to9B           RASHAQGTYEAEALHRXXXXXXXXXXXXRKAFKP-SPTAYSYTSH-YRSVLSGNFAEILAALLPCYWLYY
1to9A           AS-HAQGTYEAEALHRXXXXXXXXXXXXRKAFKP-SPTAYSYTSH-YRSVLSGNFAEILAALLPCYWLYY
2rd3D           FSNAIQDILNNEMSIHNHYIRELQITQKELQNACPTLANKSYTSYMLAEGFKGSIKEVAAAVLSCGWSYL
2rd3A           FSNAIQDILNNEMSIHNHYIRELQITQKELQNACPTLANKSYTSYMLAEGFKGSIKEVAAAVLSCGWSYL
2gm8C           ALELAYGTVTGEMANYEALLKEVGLSLRDAAEAEPNRVNVSYMAYLKSTCALEGFYQCMAALLPCFWSYA
2gm8B           ALELAYGTVTGEMANYEALLKEVGLSLRDAAEAEPNRVNVSYMAYLKSTCALEGFYQCMAALLPCFWSYA
2gm8A           ALELAYGTVTGEMANYEALLKEVGLSLRDAAEAEPNRVNVSYMAYLKSTCALEGFYQCMAALLPCFWSYA
2gm7D           ALELAYGTVTGEMANYEALLKEVGLSLRDAAEAEPNRVNVSYMAYLKSTCALEGFYQCMAALLPCFWSYA
2gm7A           ALELAYGTVTGEMANYEALLKEVGLSLRDAAEAEPNRVNVSYMAYLKSTCALEGFYQCMAALLPCFWSYA
1uddB           IE-----LARDEVTVEVENYVXXXXXXXXXXXXAIEPTLVNYMDFMLATAYKGNIIEGLTALLPCFWSYA
1uddA           IE-----LARDEVTVEVENYVXXXXXXXXXXXXAIEPTLVNYMDFMLATAYKGNIIEGLTALLPCFWSYA
1z72A           AKQ--LGFLEAEDGYFQKAFKELKVAENEVTLHPVTKA----FQDLYSAVASSDYAHLLV-LVIAEGLYL
1z72B           AKQ--LGFLEAEDGYFQKAFKELKVAENEVTLHPVTKAFQDLYSAVASSDYAHLLVLVIAEGLYLDWGSK
2a6bA           AKQ--LGFLEAEDGYFQKAFKELKVAENEVTLHPVTKAFQDLYSAVASSDYAHLLVLVIAEGLYLDWGSK
2qzcB           LNLVFSSETHGKL------YSKLDISRDVIVKTGYNLINYAYTRHLY-YYANLDWNKFLVAWTPC-FGYS
2qzcA           LNLSSKGLTHGKL------YSKLDISRDVIVKTGYNLINYAYTRHLY-YYANLDWNKFLVAWTPC-FGYS
1z6uA           WDEVLSHLVEGPNFLKKLEQSFMCVCCQELVYQPVTTECFHNVCKLQRSFK--------AQVFSCPACRH
2a2oD           FKAKAKSYDENETYHQTWHLREASIPGTDIKDYAD-----------YEAYVAGSLASPYCVVLPCEYLWP
2a2oA           FKAKAKSYDENETYHQTWHLREASIPGTDIKDYAD-----------YEAYVAGSLASPYCVVLPCEYLWP
2a2mA           FKAKAKSYDENETYHQTWHLREASIPGTDIKDYAD-----------YEAYVAGSLASPYCVVLPCEYLWP


                         +         .         .         .         .         *         .:210
query           DIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWE
2qcxB           EVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWG
2qcxA           EVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWG
1yafC           EVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWG
1yafA           EVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWG
1yakC           EVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWG
1tyhA           EVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKK-ENFVISSYYEYQFWG
1to9B           EVGEKLLHDPG-HPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKK-ENFVISSYYEYQFWG
1to9A           EVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKK-ENFVISSYYEYQFWG
2rd3D           VIAQNLSQIPNEHAFYGHWIKGYSSKEFQACVNWNINLLDSLTLASSKQEIEKLKEIFITTSEYEYLFWD
2rd3A           VIAQNLSQIPNEHAFYGHWIKGYSSKEFQACVNWNINLLDSLTLASSKQEIEKLKEIFITTSEYEYLFWD
2gm8C           EIAERHGGKLRENPVYKKWASVYLSPEYRGLVERLRAVL-----DSSGLSAEELWPYFKEASLYELEFWQ
2gm8B           EIAERHGGKLRENPVYKKWASVYLSPEYRGLVERLRAVL-----DSSGLSAEELWPYFKEASLYELEFWQ
2gm8A           EIAERHGGKLRENPVYKKWASVYLSPEYRGLVERLRAVL-----DSSGLSAEELWPYFKEASLYELEFWQ
2gm7D           EIAERHGGKLRENPVYKKWASVYLSPEYRGLVERLRAVL-----DSSGLSAEELWPYFKEASLYELEFWQ
2gm7A           EIAERHGGKLRENPVYKKWASVYLSPEYRGLVERLRAVL-----DSSGLSAEELWPYFKEASLYELEFWQ
1uddB           EIAEKDKLRDNPIKIYREWGKVYLSNEYLNLV----GRLRKIIDSSGHSGYDRLRRIFITGSKFELAFWE
1uddA           EIAEKDKLRDNPIKIYREWGKVYLSNEYLNLV----GRLRKIIDSSGHSGYDRLRRIFITGSKFELAFWE
1z72A           DWG-SKDLALPEVYIHSEWINLHRGPFFAEWVQ---FLVDELNRVGKREDLTELQQRWNQAVALELAFFD
1z72B           DLAHSEWINLHRGPFFAEWVQ-FLVDELNR----------------------------------------
2a6bA           DLAHSEWINLHRGPFFAEWVQ-FLVDELNR----------------------------------------
2qzcB           IVGD--YVIDSPNEVYKTWASFYASTEYKKRIEA------ILYALDEVSITEDLLNIFINSVRFEIGFWD
2qzcA           IVGD--YVIDSPNEVYKTWASFYASTEYKKRIEA------ILYALDEVSITEDLLNIFINSVRFEIGFWD
1z6uA           DLGQ--NYIMIPNEILQTLLDLF-----------------------------------------------
2a2oD           WIANFLDGYTPTNSLYRFWIEW-------NGGTPNGAYQGNLEQYRDKIDEDKAVEIFN-----------
2a2oA           WIANFLDGYTPTNSLYRFWIEW-------NGGTPNGAYQGNLEQYRDKIDEDKAVEIFN-----------
2a2mA           WIANFLDGYTPTNSLYRFWIEW-------NGGTPNGAYQGNLEQYRDKIDEDKAVEIFN-----------


                         .         .         .         +         .         .         .:280
query           MAYQHQTWxxxxxxxxxxxx
2qcxB           MAYRKEGW------------
2qcxA           MAYRKEGW------------
1yafC           MAYRKEGW------------
1yafA           MAYRKEGW------------
1yakC           MAYRKEGW------------
1tyhA           -AYRKEGW------------
1to9B           -AYRKEGW------------
1to9A           -AYRKEGW------------
2rd3D           MAYQ----------------
2rd3A           MAYQ----------------
2gm8C           AAYE----------------
2gm8B           AAYE----------------
2gm8A           AAYE----------------
2gm7D           AAYE----------------
2gm7A           AAYE----------------
1uddB           MAWR----------------
1uddA           MAWR----------------
1z72A           IGY-----------------
1z72B           --------------------
2a6bA           --------------------
2qzcB           --------------------
2qzcA           --------------------
1z6uA           --------------------
2a2oD           --------------------
2a2oA           --------------------
2a2mA           --------------------