[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55303.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2p1jB.bssp"
#ERROR : Can't open dsspfile "2p1jA.bssp"
#ERROR : Can't open dsspfile "1j53A.bssp"
#ERROR : Can't open dsspfile "2idoC.bssp"
#ERROR : Can't open dsspfile "2idoA.bssp"
#ERROR : Can't open dsspfile "2guiA.bssp"
#ERROR : Can't open dsspfile "3crw1.bssp"
#ERROR : Can't open dsspfile "3crvA.bssp"
#ERROR : Can't open dsspfile "2vsfA.bssp"
#ERROR : Can't open dsspfile "1hv8A.bssp"
#ERROR : Can't open dsspfile "1q0uB.bssp"
#ERROR : Can't open dsspfile "1q0uA.bssp"

## Summary of PDB Search
:816
    8e-09  30%  2p1jB  [x.x.x] DNA POLYMERASE III POLC-TYPE
    8e-09  30%  2p1jA  [x.x.x] DNA POLYMERASE III POLC-TYPE
    5e-06  28%  1j53A  [c.55.3] DNA POLYMERASE III, EPSILON CHAIN
    5e-06  28%  2idoC  [x.x.x] DNA POLYMERASE III EPSILON SUBUNIT
    5e-06  28%  2idoA  [x.x.x] DNA POLYMERASE III EPSILON SUBUNIT
    5e-06  28%  2guiA  [x.x.x] DNA POLYMERASE III EPSILON SUBUNIT
    9e-05  21%  3crw1  [x.x.x] XPD/RAD3 RELATED DNA HELICASE
    9e-05  21%  3crvA  [x.x.x] XPD/RAD3 RELATED DNA HELICASE
    2e-04  23%  2vsfA  [x.x.x] DNA REPAIR HELICASE RAD3 RELATED PROTEIN
    2e-04  37%  1hv8A  [c.37.1 - c.37.1] PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669
    3e-04  46%  1q0uB  [c.37.1] BSTDEAD
    3e-04  46%  1q0uA  [c.37.1] BSTDEAD
:816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYTTDVNPHEPLDAHIKELTGLTDQRLAQAP
2p1jB           ----------------------------------------YHTLIKPSREISRKSSEITGITQEMLENKR
2p1jA           ----------------------------------------YHTLIKPSREISRKSSEITGITQEMLENKR
1j53A           --------------------------------------------LKPDRLVDPEAFGVHGIADEFLLDKP
2idoC           --------------------------------------------LKPDRLVDPEAFGVHGIADEFLLDKP
2idoA           --------------------------------------------LKPDRLVDPEAFGVHGIADEFLLDKP
2guiA           --------------------------------------------LKPDRLVDPEAFGVHGIADEFLLDKP
3crw1           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
2vsfA           ----------------------------------------------------------------------
1hv8A           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DFSQVARKIFDLVEDGIFVAHNVQFDANLLAENLFFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRE
2p1jB           SIEEVLPEFLGFLEDSIIVAHNANFDYRFL--RLWIKGLDWERPYIDTXXXXXXXXXXXXXXXXXVV-EK
2p1jA           SIEEVLPEFLGFLEDSIIVAHNANFDYRFL--RLWIKGLDWERPYIDTXXXXXXXXXXXXXXXXXVV-EK
1j53A           TFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTDSLAVARKMFPG-KRNSLDALCAE
2idoC           TFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTDSLAVARKMFPG-KRNSLDALCAE
2idoA           TFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTDSLAVARKMFPG-KRNSLDALCAR
2guiA           TFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTDSLAVARKMFPG-KRNSLDALCAE
3crw1           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
2vsfA           ----------------------------------------------------------------------
1hv8A           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGIPLKHAHTALSDAQATAELLLFLREKMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2p1jB           LGLPFRH-HRALDDARVTAQVFLRFVEMM-----------------------------------------
2p1jA           LGLPFRH-HRALDDARVTAQVFLRFVEMM-----------------------------------------
1j53A           IDNSKRTLHGALLDAQILAEVYL-----------------------------------------------
2idoC           IDNSKRTLHGALLDAQILAEVYL-----------------------------------------------
2idoA           YEID-NSLHGALLDAQILAEVYL-----------------------------------------------
2guiA           IDNSKRTLHGALLDAQILAEVYL-----------------------------------------------
3crw1           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
2vsfA           ----------------------------------------------------------------------
1hv8A           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGY
2p1jB           ----------------------------------------------------------------------
2p1jA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2idoC           ----------------------------------------------------------------------
2idoA           ----------------------------------------------------------------------
2guiA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
2vsfA           ----------------------------------------------------------------------
1hv8A           ------------------------------------EKPTDIQKVIPLFLNDEYNIVAQARTGSGKTASF
1q0uB           -------------------------------------------------------SVGQSQTGTGKTHAY
1q0uA           -------------------------------------------------------SVGQSQTGTGKTHAY


                         .         *         .         .         .         .         +:350
query           LLPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYxxxxxxxxxxxx
2p1jB           ----------------------------------------------------------------------
2p1jA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2idoC           ----------------------------------------------------------------------
2idoA           ----------------------------------------------------------------------
2guiA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
2vsfA           ----------------------------------------------------------------------
1hv8A           AIPLIELVNENEAIILTPTRELAIQVADE------------IESLKGNKN-LKIAKIY------------
1q0uB           LLPIEKIKPERQAVITAPTRELATQIYHETLKITK-----------------------------------
1q0uA           LLPIEKIKPERQAVITAPTRELATQIYHETLKITK-----------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2p1jB           ----------------------------------------------------------------------
2p1jA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2idoC           ----------------------------------------------------------------------
2idoA           ----------------------------------------------------------------------
2guiA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
2vsfA           ----------------------------------------------------------------------
1hv8A           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2p1jB           ----------------------------------------------------------------------
2p1jA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2idoC           ----------------------------------------------------------------------
2idoA           ----------------------------------------------------------------------
2guiA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
2vsfA           ----------------------------------------------------------------------
1hv8A           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2p1jB           ----------------------------------------------------------------------
2p1jA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2idoC           ----------------------------------------------------------------------
2idoA           ----------------------------------------------------------------------
2guiA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
2vsfA           ----------------------------------------------------------------------
1hv8A           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxQVLGVSATLEISQRVSLADLLGYPEAKFVKIESRGKQEQEVVMVKDFPLVTETSLEVYA
2p1jB           ----------------------------------------------------------------------
2p1jA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2idoC           ----------------------------------------------------------------------
2idoA           ----------------------------------------------------------------------
2guiA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
2vsfA           -----------EVLKESKTIHMSGTLDYSDITGF-EIPFKKIGEIFPPENRYIAYYDYDTLDEKELDRMA
1hv8A           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           REVAALLVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLGAASFWE
2p1jB           ----------------------------------------------------------------------
2p1jA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2idoC           ----------------------------------------------------------------------
2idoA           ----------------------------------------------------------------------
2guiA           ----------------------------------------------------------------------
3crw1           ----------------VLVVFPSYEIMDRVMSRISLPKYVESEDSSVEDLYSAISANNKVLIVGKGKLAE
3crvA           ----------------VLVVFPSYEIMDRVMSRISLPKYVESEDSSVEDLYSAISANNKVLIVGKGKLAE
2vsfA           TVIEDIILKVK---KNTIVYFPSYSLMDRVENRVSFEHMKEYRGIDLYSMLKKFRRDHGTIFVSGGRLSE
1hv8A           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           GVDFSSHPFVIQVVPRLPFQNPQEPLTKKINQELNQEGKNAFYDYQLPMAIIRLKQALGRSMRREYQRSL
2p1jB           ----------------------------------------------------------------------
2p1jA           ----------------------------------------------------------------------
1j53A           ----------------------------------------------------------------------
2idoC           ----------------------------------------------------------------------
2idoA           ----------------------------------------------------------------------
2guiA           ----------------------------------------------------------------------
3crw1           GIELRNNDVVIVGIPYPPPDDYLKILAQRVSLKMNRE--NEEFLFKIP-ALVTIKQAIGRAIRDVNDKCN
3crvA           GIELRNNDVVIVGIPYPPPDDYLKILAQRVSLKMNRE--NEEFLFKIP-ALVTIKQAIGRAIRDVNDKCN
2vsfA           GNELE-----MIILAGLPFPRPDAINRSLFDYYERKYGKGWEYSVVYPTAI-KIRQEIGRLIRSAEDTGA
1hv8A           ----------------------------------------------------------------------
1q0uB           ----------------------------------------------------------------------
1q0uA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           TLILDRRIVGKRYGKQIxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2p1jB           ----------------------------------------------
2p1jA           ----------------------------------------------
1j53A           ----------------------------------------------
2idoC           ----------------------------------------------
2idoA           ----------------------------------------------
2guiA           ----------------------------------------------
3crw1           VWLLDKRFESLYWKKNL-----------------------------
3crvA           VWLLDKRFESLYWKKNL-----------------------------
2vsfA           CVILDKR---------------------------------------
1hv8A           ----------------------------------------------
1q0uB           ----------------------------------------------
1q0uA           ----------------------------------------------