[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:greA

[Show Plain Result]

#ERROR : Can't open dsspfile "1grjA.bssp"
#ERROR : Can't open dsspfile "2etnB.bssp"
#ERROR : Can't open dsspfile "2etnA.bssp"
#ERROR : Can't open dsspfile "2p4vA.bssp"
#ERROR : Can't open dsspfile "2f23A.bssp"
#ERROR : Can't open dsspfile "2eulA.bssp"
#ERROR : Can't open dsspfile "3bmbA.bssp"
#ERROR : Can't open dsspfile "2pn0D.bssp"
#ERROR : Can't open dsspfile "2pn0C.bssp"
#ERROR : Can't open dsspfile "2pn0A.bssp"

## Summary of PDB Search
:160
    1e-16  41%  1grjA  [x.x.x] GREA PROTEIN
    2e-11  30%  2etnB  [x.x.x] ANTI-CLEAVAGE ANTI-GREA TRANSCRIPTION FACTOR
    2e-11  30%  2etnA  [x.x.x] ANTI-CLEAVAGE ANTI-GREA TRANSCRIPTION FACTOR
    8e-11  32%  2p4vA  [x.x.x] TRANSCRIPTION ELONGATION FACTOR GREB
    8e-11  30%  2f23A  [x.x.x] ANTI-CLEAVAGE ANTI-GREA TRANSCRIPTION FACTOR
    1e-10  30%  2eulA  [x.x.x] ANTI-CLEAVAGE ANTI-GREA TRANSCRIPTION FACTOR
    1e-04  24%  3bmbA  [x.x.x] REGULATOR OF NUCLEOSIDE DIPHOSPHATE KINASE
    7e-04  30%  2pn0D  [x.x.x] PROKARYOTIC TRANSCRIPTION ELONGATION FACTOR
    7e-04  30%  2pn0C  [x.x.x] PROKARYOTIC TRANSCRIPTION ELONGATION FACTOR
    7e-04  30%  2pn0A  [x.x.x] PROKARYOTIC TRANSCRIPTION ELONGATION FACTOR
:160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
1grjA           ----------------------------------------HGDLKENAEYHAAREQQGFCEGRIKDIEAK
2etnB           ---------------------------------------------DDSGLEAAKQEKARIEARIDSLEDV
2etnA           ---------------------------------------------DDSGLEAAKQEKARIEARIDSLEDV
2p4vA           ---------------------------RPEVTKKVTWAASLGDRSENADYQYNKKRLREIDRRVRYLTKC
2f23A           ---------------------------------------------DDSGLEAAKQEKARIEARIDSLEDI
2eulA           ---------------------------------------------DDSGLEAAKQEKARIEARIDSLEDI
3bmbA           -----------------------------------------------------------------ALNAE
2pn0D           ------------------------------------------------------------------LEAE
2pn0C           ------------------------------------------------------------------LEAE
2pn0A           ------------------------------------------------------------------LEAE


                         .         .         *         .         .         .         .:140
query           IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
1grjA           LSNAQVIDVTKMPNNRVIFGATVTVLNLDSDEEQTYRIVGDDEADFKQNLISVNSPIARGLIG-------
2etnB           LSRAVILEEGT--GEVIGLGSVVELEDPATGERLSVQVVSPAEASVLENKISDASPMGKALLGHRVGDVL
2etnA           LSRAVILEEGT--GEVIGLGSVVELEDPATGERLSVQVVSPAEASVLENKISDASPMGKALLGHRVGDVL
2p4vA           MENLKIVDYSPQQEGKVFFGAWVEI----ENDDGVTHRFRIVGYDEIFGRISIDSPMARALLKKEVGDLA
2f23A           LSRAVILEEGS--GEVIGLGSVVELEDPLSGERLSVQVVSPAEANVLDTKISDASPMGKALLGHRVGDVL
2eulA           LSRAVILEEGS--GEVIGLGSVVELEDPLSGERLSVQVVSPAEANVLDTKISDASPMGKALLGHRVGDVL
3bmbA           LDRAQMCSPEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSI
2pn0D           LARAEVVDPEEIPPT-VVTNSTVRFR-VESSAEEFLTLVYPKDVDTSGEKISILAPVGSALLGLAQGDEI
2pn0C           LARAEVVDPEEIPPT-VVTNSTVRFR-VESSAEEFLTLVYPKDVDTSGEKISILAPVGSALLGLAQGDEI
2pn0A           LARAEVVDPEEIPPT-VVTNSTVRFR-VESSAEEFLTLVYPKDVDTSGEKISILAPVGSALLGLAQGDEI


                         +         .         .         .         .         *         .:210
query           TIETPVGSYDVKILKVExxx
1grjA           --------------------
2etnB           SLDTPKGKKEFRVVAI----
2etnA           SLDTPKGKKEFRVVAI----
2p4vA           VVNTPAG-------------
2f23A           SLDTPKGKREFRVVAI----
2eulA           SLDTPKGRREFRVVAI----
3bmbA           HWELPGGATHLEVLELE---
2pn0D           EWPKPGGGLRVRIVEV----
2pn0C           EWPKPGGGLRVRIVEV----
2pn0A           EWPKPGGGLRVRIVEV----