[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:radC

[Show Plain Result]

#ERROR : Can't open dsspfile "2qlcE.bssp"
#ERROR : Can't open dsspfile "2qlcD.bssp"
#ERROR : Can't open dsspfile "2qlcC.bssp"
#ERROR : Can't open dsspfile "2qlcB.bssp"
#ERROR : Can't open dsspfile "2qlcA.bssp"

## Summary of PDB Search
:226
    3e-21  43%  2qlcE  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
    3e-21  43%  2qlcD  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
    3e-21  43%  2qlcC  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
    3e-21  43%  2qlcB  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
    3e-21  43%  2qlcA  [x.x.x] DNA REPAIR PROTEIN RADC HOMOLOG
:226

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2qlcE           ----------------------------------------------------------------------
2qlcD           ----------------------------------------------------------------------
2qlcC           ----------------------------------------------------------------------
2qlcB           ----------------------------------------------------------------------
2qlcA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMQQELGDKKQEHLVALYLXXXXXXXXX
2qlcE           -------------------------------------------MKGRIPDETKEHLFVLFLSTKNQILRH
2qlcD           -------------------------------------------MKGRIPDETKEHLFVLFLSTKNQILRH
2qlcC           -------------------------------------------MKGRIPDETKEHLFVLFLSTKNQILRH
2qlcB           -------------------------------------------MKGRIPDETKEHLFVLFLSTKNQILRH
2qlcA           -------------------------------------------MKGRIPDETKEHLFVLFLSTKNQILRH


                         +         .         .         .         .         *         .:210
query           XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
2qlcE           ETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLDHVI
2qlcD           ETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLDHVI
2qlcC           ETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLDHVI
2qlcB           ETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLDHVI
2qlcA           ETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLDHVI


                         .         .         .         +         .         .         .:280
query           VSHSNYFSYRExxxxx
2qlcE           VGNNDWFSFRD-----
2qlcD           VGNNDWFSFRD-----
2qlcC           VGNNDWFSFRD-----
2qlcB           VGNNDWFSFRD-----
2qlcA           VGNNDWFSFRD-----