[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55806.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1ii8B.bssp"
#ERROR : Can't open dsspfile "1f2uD.bssp"
#ERROR : Can't open dsspfile "1f2uB.bssp"
#ERROR : Can't open dsspfile "1f2tB.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1us8B.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"

## Summary of PDB Search
:234
    1e-24  31%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    7e-24  31%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-20  32%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-20  32%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-16  32%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-16  32%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    3e-16  29%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-16  29%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-15  32%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-15  33%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    4e-15  32%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-15  32%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-14  26%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-14  29%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-14  29%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-14  31%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    5e-14  27%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    9e-14  30%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    9e-14  30%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    9e-14  29%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    9e-14  27%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    1e-13  32%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  27%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-13  35%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    2e-13  32%  1yqtA  [x.x.x] RNASE L INHIBITOR
    2e-13  27%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    3e-13  27%  2oukB  [x.x.x] PROTEIN ARTP
    4e-13  31%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-13  29%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    1e-12  36%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-12  26%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-12  26%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-12  28%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-12  31%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  27%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    2e-12  29%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-12  27%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-12  27%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-12  27%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-12  29%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  31%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  29%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  29%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  34%  1ji0A  [c.37.1] ABC TRANSPORTER
    4e-12  31%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  31%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  31%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  25%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    4e-12  25%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    5e-12  26%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-12  26%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-12  34%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    5e-12  26%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    6e-12  28%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    6e-12  28%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    8e-12  29%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-12  31%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-11  29%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-11  28%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    1e-11  28%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-11  26%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-11  31%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-11  27%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-11  27%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-11  28%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-11  31%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-11  33%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    5e-11  31%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-11  30%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-11  30%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    9e-11  30%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    9e-11  28%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  31%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  31%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  31%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  31%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  34%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    2e-10  27%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-10  23%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    2e-10  27%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-10  26%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    3e-10  31%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    4e-10  31%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-10  30%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-10  25%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-10  30%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  30%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-10  31%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    1e-09  24%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    1e-09  24%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    3e-09  26%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    5e-09  29%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    9e-09  30%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-08  24%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    3e-08  24%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    3e-06  33%  1ii8B  [c.37.1] RAD50 ABC-ATPASE
    3e-06  33%  1f2uD  [c.37.1] RAD50 ABC-ATPASE
    3e-06  33%  1f2uB  [c.37.1] RAD50 ABC-ATPASE
    3e-06  33%  1f2tB  [c.37.1] RAD50 ABC-ATPASE
    4e-06  34%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    4e-06  34%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    4e-06  34%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    9e-06  30%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-05  30%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-05  30%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-05  32%  1us8B  [c.37.1] DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
    2e-05  31%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-05  31%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-05  29%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-05  31%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    4e-05  31%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    1e-04  30%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-04  30%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-04  32%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    4e-04  30%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-04  30%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
:234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRYITVEDLSFYYDKEPVLEHINYCVDSGEFVTLTGENGAAXTTLIKASLGILQPRIGKVAISKTNTQGK
2nq2C           ---LSVENLGFYYQAENFLQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVYQS-----
2nq2D           ---LSVENLGFYYQ---AFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVYQS-----
3fvqB           --------LSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSNTNLPVR
3fvqA           --------LSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSNTNLPVR
2it1B           ---IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDETELPPK
2it1A           ---IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDETELPPK
2yz2B           --------------EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGY
2yz2A           --------------EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGY
3bk7A           -------------------------IRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLT-----
3gfoA           ---LKVEELNYNYDGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDYS
1l2tB           ------------------LKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDKTNTKIR
1l2tA           ------------------LKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDKTNTKIR
2yyzA           ---IRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDI
1oxvA           ---IIVKNVSKVFKKGKVLDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDVPPEDR
1oxsC           ---IIVKNVSKVFKKGKVLDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDVPPEDR
3dhwC           ------------------LNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQETTLS
3d31A           ---IEIESLSRKW-KNFSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGTDLSPE
1sgwA           ---LEIRDLSVGYDK-PVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKV
1pf4A           ---VDVKDVTFTYQEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDY
1jj7A           ---VQFQDVSFAYPNRPVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLD-----GK
1g291           -------------------------VKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADP
1xmiB           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
1vplA           ---VVVKDLRKRIGKKEILKXXXXXXXXXXXXXXXXPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVEVR
2hydA           ---IDIDHVSFQYNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNI--K
1yqtA           -------------------------IKKGEVIGIVGPNGIGKTTFVKLA-GVEEPTEGKIEWDLT-----
2oljA           LQMIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRC-LNLLEDXXXXXXXXXXNLKAK
2oukB           ---IDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRC-LNLLEDXXXXXXXXXXNLKAK
2pzfA           ---VVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
2pcjA           -----------------ILKGISLSVKKGEFVSIIGASGSGKSTLLYI-LGLLDPTEGKVEVDYTNEKNR
1f3oA           ------------------LKNVNLNIKEGEFVSI-GPSGSGKSTL--NIIGCLKPTEGEVYIDKTNTKIR
2ixfC           ---VKFQDVSFAYPNHPVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDQYDHHYL
2ixfA           ---VKFQDVSFAYPNHPVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDQYDHHYL
2awoC           -----------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE-----K
1xmiD           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
1q12A           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI------GE
2ixfD           ---VKFQDVSFAYPNHPVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD-----GE
3fh6A           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI------GE
2awoA           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI------GE
2awnB           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI------GE
2pzgA           ---VVMENVTAFWEETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
2pzfB           ---VVMENVTAFWEETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
2pzeB           ---VVMENVTAFWEETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
2pzeA           ---VVMENVTAFWEETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
1ji0A           ---LEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNK
1xmiE           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
1xmiC           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
1xmiA           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
1gajA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1g6hA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
2r6gB           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI------GE
2r6gA           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI------GE
2ghiA           ---IEFSDVNFSYPKQTTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAKIGGKNVNKYNRNSI
1g9xA           MEILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
3g60A           ----------------PVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLD--GKEIK
3g5uA           ----------------PVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLD--GKEIK
2pzgB           ---VVMENVTAFWEETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
2awnC           -----------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL---GVGMVFQS-------
2d62A           -------------------------IKDGEFLVLLGPSGCGKTTTLRIA-GLEEPTRGQIYIEDNLVADP
1mt0A           ---ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIALADPNWL
2ff7A           ---ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIALADPNWL
2ixeA           ---VKFQDVSFAYPNHPVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDQYDHHYL
2bbsA           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
2fgkA           ---ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIALADPNWL
2ffbA           ---ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIALADPNWL
3b5jA           ---ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIALADPNWL
2bbtB           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
2ghiB           ---IEFSDVNFSYPKQTTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAKIGGKNVNKYNRNSI
2bbtA           ----------------PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
1xmjA           ---VVMENVTAFWET-PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
2ixeD           ---VKFQDVSFAYPNHPVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD-----GE
2cbzA           ---ITVRNATFTWARSPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAI--------
2bboA           ---VVMENVTAFWEETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
1xf9D           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1xf9C           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1xf9B           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1xf9A           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1b0uA           ------------------------------------------------NINLVRDKDGQLKVADKN-QLR
1xefA           ---ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIALADPNWL
1v43A           ---VKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRD----
2ffaA           ---ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIALADPNWL
2onkA           -----------------------------DYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGTPLPPE
2ghiD           ---IEFSDVNFSYHR--TLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAKIGGKNVNKYNRNSI
2bbsB           -----------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------
1xfaA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
2ixgA           ---VKFQDVSFAYPNHPVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDQYDHHYL
1r10A           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0zD           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0zC           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0zB           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0zA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0xD           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0xC           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0xB           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0xA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0wC           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0wB           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1r0wA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1q3hD           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1q3hC           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1q3hB           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
1q3hA           ----------------PVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------
2ghiC           ---IEFSDVNFSYPKQTTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAKIGGKNVNKYNRNSI
1mv5D           -----------YDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDNISLENW
1mv5A           -----------YDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDNISLENW
1oxxK           ---IIVKNVSKVFKKGKVLDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDVPPEDR
2pjzA           ------------------LENINLEVN-GEKVIILGPNGSGKTTLLRAISGLL-PYSGNIFINGMEVRKI
2ihyB           -----------------ILKKISWQIAKGDKWILYGLNGAGKTTLLNI-LNAYEPATS----GTVNLFGK
1z47B           ---------------------VSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGTDLPPQ
1z47A           ---------------------VSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGTDLPPQ
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2zu0C           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVGKLALSPEDRAGE
2d3wA           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVGKLALSPEDRAGE
1us8B           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ihyA           -----------------ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLGKPGYSAE
2ix3A           ---VKVTNMEFQYPSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEVYTH------E
2iwhB           ---VKVTNMEFQYPSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEVYTH------E
2awnD           ----------------------------------------------------------------------
2d3wD           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVGKLALSPEDRAGE
1e69A           ----------------------------------------------------------------------
2d3wC           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVGKLALSPEDRAGE
2d3wB           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVGKLALSPEDRAGE


                         .         .         *         .         .         .         .:140
query           KLRIAYLPQQIASFNAGFPSTVYEFVKSGRYPRKGWFRRLNAHDEEHIKASLDSVGMWEHRDKRLGSLSG
2nq2C           ---IGFVPQ---FFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTSLSG
2nq2D           ---IGFVPQ---FFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTSLSG
3fvqB           ERRLGYLVQE----GVLFPHTVYRNIAYGLGNGKG----RTAQERQRIEAMLELTGISELAGRYPHELSG
3fvqA           ERRLGYLVQE----GVLFPHTVYRNIAYGLGNGKG----RTAQERQRIEAMLELTGISELAGRYPHELSG
2it1B           DRNVGLVFQNWALYPH---MTVY---KNIAFPLE-----LRKAPREEIDKKVREVAKMLHIDKLLNQLSG
2it1A           DRNVGLVFQNWALYPH---MTVY---KNIAFPLE-----LRKAPREEIDKKVREVAKMLHIDKLLNQLSG
2yz2B           EIRIAFQYPE----DQFFAERVFDFAVKNFYPDRD--------PVPLVKKAMEFVGLDSFKDRVPFFLSG
2yz2A           EIRIAFQYPE----DQFFAERVFDFAVKNFYPDRD--------PVPLVKKAMEFVGLDSFKDRVPFFLSG
3bk7A           ---VAYKPQYI---KAEYEGTVYELLS------KIDSSKLNSNFYK--TELLKPLGIIDLYDRNVEDLSG
3gfoA           RKGIMKLRESIGIVNQLFSASVYQDVSFGAVNMK--------LPEDEIRKRVDNAGIEHLKDKPTHCLSF
1l2tB           RDKIGFVFQQ---FNLIPLLTALENVE---LPLIFKYRGAMS-GEERRKRALECLKMAELEERKPNQLSG
1l2tA           RDKIGFVFQQ---FNLIPLLTALENVE---LPLIFKYRGAMS-GEERRKRALECLKMAELEERKPNQLSG
2yyzA           PPKYREVGMVFQNYALYPHMTVFENIA---FPLRA--RRISKDEVEKRVVEIARKLLIDNLDRKPTQLSG
1oxvA           KIGMVFYPNLTAFENIAFPLTNMKMSKEEIRKRV-----------EEVAKILDIHHVLNHFPREL---SG
1oxsC           KIGMVFYPNLTAFENIAFPLTNMKMSKEEIRKRV-----------EEVAKILDIHHVLNHFPREL---SG
3dhwC           ESELTKARRQIGMFNLLSSRTVFGNVELDNTPKDEVKRR--------VTELLSLVGLGDKHDSYPSNLSG
3d31A           KHDIAFVYQNYSLFPHMNVKKNLEF----------GMRMKKIKDPKRVLDTARDLKIEHLLDRNPLTLSG
1sgwA           KGKIFFLPEEII---VPRKISVEDYLKASLYGVK--------VNKNEIMDALESVEVLDLK-KKLGELSQ
1pf4A           KLHFALVSQNVHLFNDTIANNI-AYAAEGEYTREQIEQAARAHAMEFIE------NMPQGLDTVIGSLSG
1jj7A           PLEHRYLHRQVAAVGQEFGRSLQENIAYGQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSG
1g291           EKGIFVPPKDVFQSYALYPHTVYDNIA---FPLK--LRKVPRQEDQRVREVAELLGLTELLNRKPRELSG
1xmiB           --RISFCSQ----FSWIMPGTIKENIIAGV-----------SYDEYRYRSVIKACQLEEDISKIVLTLSG
1vplA           KL-ISYLPEEAGAYRNMQGIEYLRFVA-------GFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSK
2hydA           DFLTGSLRNQIGLVNILFSDTVKENILLGRP---------TATDEEVVEAAKMAMNLPQGYDTEVGELSG
1yqtA           ---VAYKPQYI---KADYEGTVYELLS------KIDASKLNSNFYK--TELLKPLGIIDLYDREVNELSG
2oljA           DTNLNKVREEVGMFNLFPHMTVLNNITLAPMKVRKWPRE---KAEAKAMELLDKVGLKDKAHAYPDSLSG
2oukB           DTNLNKVREEVGMFNLFPHMTVLNNITLAPMKVRKWPRE---KAEAKAMELLDKVGLKDKAHAYPDSLSG
2pzfA           --RISFCSQ----FSWIMPGTIKENIIGVSYDEYRYRSVIKACQEEDISAEKDNIVLGEGGI----TLSG
2pcjA           KLGFVFQFHYLIPELTALENVIVPMLKMGK-PKK--------EAKERGEYLLSELGLGDKLSRKPYELSG
1f3oA           RDKIGFVFQQ---FNLIPLLTALENVELPLI-----FKYRGASGEERRKRALECLAELEERNHKPNQLSG
2ixfC           HTQVAAVGQEPLLFGRSFRENIAYGLT--RTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSG
2ixfA           HTQVAAVGQEPLLFGRSFRENIAYGLT--RTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSG
2awoC           RMNDTPPAERGVGMVALYPHSVAENMSFGL--------KLAGAKKEVINQRVNQVALAHLLDRKPKALSG
1xmiD           --RISFCSQ----FSWIMPGTIKENIIAGEYRYRSVIKACQLEEDISKFAEKDNIVLGEI------TLSG
1q12A           K-RMNDTPPAERGVGMVFQSALYPHLSVAENMSFGL--KLAGAKKEVINQRVNQVALAHLLDRKPKALSG
2ixfD           PLDHHYLHTQVAAVGQLFGRSFRENIAYGRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSG
3fh6A           K-RMNDTPPAERGVGMVFQSALYPHLSVAENMSFGL--KLAGAKKEVINQRVNQVALAHLLDRKPKALSG
2awoA           K-RMNDTPPAERGVGMVFQSALYPHLSVAENMSFGL--KLAGAKKEVINQRVNQVALAHLLDRKPKALSG
2awnB           K-RMNDTPPAERGVGMVFQSALYPHLSVAENMSFGL--KLAGAKKEVINQRVNQVALAHLLDRKPKALSG
2pzgA           --RISFCSQ----FSWIMPGTIKENIIFGEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI----TLSG
2pzfB           --RISFCSQ----FSWIMPGTIKENIIGVSYDEYRYRSVIKACQEEDISAEKDNIVLGEGGI----TLSG
2pzeB           --RISFCSQ----FSWIMPGTIKENIIFGEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI----TLSG
2pzeA           --RISFCSQ----FSWIMPGTIKENIIFGEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI----TLSG
1ji0A           PAHV--INRGIALVPEGFPETVYE--NLGAYNRK---------DKEGIKRDLEWISLFPRLKERLGTLSG
1xmiE           --RISFCSQ----FSWIMPGTIKENIIAGEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI----TLSG
1xmiC           --RISFCSQ----FSWIMPGTIKENIIAGEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI----TLSG
1xmiA           --RISFCSQ----FSWIMPGTIKENIIAGEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI----TLSG
1gajA           EPAELYHYGIVRTFQTPQPMTVLENINPGESPLNSLFKKWIPKEEEMVEKALEFLKLSHLYDRKAGELSG
1g6hA           EPAELYHYGIVRTFQTPQPMTVLENLLIGEIPGESFYKKWIPKEEEMVEKALEFLKLSHLYDRKAGELSG
2r6gB           K-RMNDTPPAERGVGMVFQSALYPHLSVAENMSFGL--KLAGAKKEVINQRVNQVALAHLLDRKPKALSG
2r6gA           K-RMNDTPPAERGVGMVFQSALYPHLSVAENMSFGL--KLAGAKKEVINQRVNQVALAHLLDRKPKALSG
2ghiA           RSIIGIVPQDTILFNETIKYNIL-------------YGKLDATDEEVIKATKSAQALPKKWDTIVGNLSG
1g9xA           EPAELYHYGIVRTFQTPQPMTVLENINPGESPLNSLFKKWIPKEEEMVEKALEFLKLSHLYDRKAGELSG
3g60A           QLNVQWLRAQLGIVSQEFDCSIAENIAYGDNSRVVSYEEIRAAKEANIHQFIDSLP--DKYNTRVGDLSG
3g5uA           QLNVQWLRAQLGIVSQEFDCSIAENIAYGDNSRVVSYEEIRAAKEANIHQFIDSLP--DKYNTRVGDLSG
2pzgB           --RISFCSQ----FSWIMPGTIKENIIFGEYRYRSVIKACQLEEDISKFAEKDNIVLGI-------TLSG
2awnC           ---YALYPHLSVAENMSFG------LKLAGAKKEVINQRVNQVAEVLQLAHL--------LDRKPKALSG
2d62A           EKGVFVPPKEVAVFQALYPHTVYDNIA---FPLK--LRKVPKQEIDKRVREVAELGLTELLNRKPRELSG
1mt0A           RRQVGVVLQDNVLLNRSIIDNI-SLANPGMSVEKVIYKLAGAHDFSELREGYNTIV-----GEQGAGLSG
2ff7A           RRQVGVVLQDNVLLNRSIIDNI-SLANPGMSVEKVIYKLAGAHDFSELREGYNTIV-----GEQGAGLSG
2ixeA           HTQVAAVGQEPLLFGRSFRENIAYGLT--RTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSG
2bbsA           --RISFCSQN----SWIMPGTIKENIIGVSYDEYRYRSVIKACQLE------EDISKFAEKDNVLITLSG
2fgkA           RRQVGVVLQDNVLLNRSIIDNI-SLANPGMSVEKVIYKLAGAHDFSELREGYNTIV-----GEQGAGLSG
2ffbA           RRQVGVVLQDNVLLNRSIIDNI-SLANPGMSVEKVIYKLAGAHDFSELREGYNTIV-----GEQGAGLSG
3b5jA           RRQVGVVLQDNVLLNRSIIDNI-SLANPGMSVEKVIYKLAGAHDFSELREGYNTIV-----GEQGAGLSG
2bbtB           --RISFCSQN----SWIMPGTIKENIIGVSYDEYRYRSVIKACQLE------EDISKFAEKDNVLGTLSG
2ghiB           RSIIGIVPQDTILFNETIKYNIL-------------YGKLDATDEEVIKATKSAQKKWDTIVGNKMKLSG
2bbtA           --RISFCSQN----SWIMPGTIKENIIGVSYDEYRYRSVIKACQLE------EDISKFAEKDNVLGTLSG
1xmjA           --RISFCSQ----FSWIMPGTIKENIIGVSYDEYRYRSVIKACQEEDISAEKDNIVLGEGGI----TLSE
2ixeD           PLDHHYLHTQVAAVGPLFGRSFRENIAYGRTPTMEEITAVAMESGAHDFIS----GFPQGYDTEV-QLSG
2cbzA           KGSVAYVPQQAWIQN----DSLRENILFGCQLEEPYYRSIQACALLPDLEILPSGDRTEIGEKGV-NLSG
2bboA           --RISFCSQ----FSWIMPGTIKENIIFGEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI----TLSE
1xf9D           --RVSFCSQ----FSWIMPGTIKENIISGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1xf9C           --RVSFCSQ----FSWIMPGTIKENIISGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1xf9B           --RVSFCSQ----FSWIMPGTIKENIISGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1xf9A           --RVSFCSQ----FSWIMPGTIKENIISGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1b0uA           LLRTR-LTMVFQHFNLWSHMTVLENVMEAPIQVLG----LSKHDRERALKYLAKVGIDERQGKYPVHLSG
1xefA           RRQVGVVLQDNVLLNRSIIDNI-SLANPGMSVEKVIYKLAGAHDFSELREGYNTIV-----GEQGAGLSG
1v43A           ---VTYLPPKDRNISMVFQMTVYENI---AFPLKKFPK---DEIDKRVRWAAELLQIEELLNRYPAQLSG
2ffaA           RRQVGVVLQDNVLLNRSIIDNI-SLANPGMSVEKVIYKLAGAHDFSELREGYNTIV-----GEQGAGLSG
2onkA           RRGIGFVPQDYALFPH---LSVYRNIAYGLXXXXXXXXXXXXXX------MAEKLGIAHLLDRKPARLSG
2ghiD           RSIIGIVPQDTILFNETIKYNIL-------------YGKLDATDEEVIKASAQLYDFIEALPKKWDTLSG
2bbsB           --RISFCSQN----SWIMPGTIKENIIGVSYDEYRYRSVIKACQLE------EDISKFAEKDNVLGTLSG
1xfaA           --RVSFCSQ----FSWIMPGTIKENIIRGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
2ixgA           HTQVAAVGQEPLLFGRSFRENIAYGLT--RTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLAV
1r10A           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0zD           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0zC           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0zB           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0zA           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0xD           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0xC           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0xB           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0xA           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0wC           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0wB           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1r0wA           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1q3hD           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1q3hC           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1q3hB           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
1q3hA           --RVSFCSQ----FSWIMPGTIKENIIFGEYRYKSVVKACQLQQDITKFAEQDNTVLGEGG----VTLSG
2ghiC           RSIIGIVPQDTILFNETIKYNIL-------------YGKLDA-TEEVIKATKSAQALPKKWDTIVGGMKL
1mv5D           RSQIGFVSQDSAIM-AGTIRENLTYGLEGDYTDEDLWQVLDAFARSFVENMPDQLNT--EVGERGVKISG
1mv5A           RSQIGFVSQDSAIM-AGTIRENLTYGLEGDYTDEDLWQVLDAFARSFVENMPDQLNT--EVGERGVKISG
1oxxK           KIGMVFYPNLTAFENIAFPLTNMKMSKEEIRKRV-----------EEVAKILDIHHVLNHFPREL---SG
2pjzA           RNYIRYSTNLPEAYEIGV--TVNDIVYL--------YEELKGLDRDLFLEMLKALKLGEEILRRLYKLSA
2ihyB           PGKVGYSAETVRQ-HIGFVSRVIDVVISGAFKSIGVYQDIDDEIRNEAHQLLKLVGSAKAQ-QYIGYLST
1z47B           KRNVGLVFQNYALFQH---MTVYDNVSFGLREKRVPKDEMDAR----VRELLRFMRLESYANRFPHELSG
1z47A           KRNVGLVFQNYALFQH---MTVYDNVSFGLREKRVPKDEMDAR----VRELLRFMRLESYANRFPHELSG
1ii8B           --------------------------------------------------------VWEGKERPLTFLSG
1f2uD           --------------------------------------------------------VWEGKERPLTFLSG
1f2uB           --------------------------------------------------------VWEGKERPLTFLSG
1f2tB           --------------------------------------------------------VWEGKERPLTFLSG
2ix8A           ----------------------------------GQFRPLTRKEEEHCSLGLDPEIV---SHSRIRGLSG
2iw3B           ----------------------------------GQFRPLTRKEEEHCSLGLDPEIV---SHSRIRGLSG
2iw3A           ----------------------------------GQFRPLTRKEEEHCSLGLDPEIV---SHSRIRGLSG
2awnA           ----------------------------------------------------------------------
2zu0C           GIFMAFYPVEIPGVNQFFLQTALNAVRS--YRGQETLDRFDFQDLMEEKIAL--LKMPEDRSVNVG-FSG
2d3wA           GIFMAFYPVEIPGVNQFFLQTALNAVRS--YRGQETLDRFDFQDLMEEKIAL--LKMPEDRSVNVG-FSG
1us8B           ---------------------------------------------------------WEGKERPLTFLRG
2r6fB           --------------------------------------------------TLYDVGLGYKLGQPATTLSG
2r6fA           --------------------------------------------------TLYDVGLGYKLGQPATTLSG
2ihyA           TVRIGFVSHSLLEFQEG--ERVIDVVISGAIDDE---IRNEAHQLLKLVGSAKA-------QQYIGYLST
2ix3A           NCRIAYIKQHFAHIESHLDKTPSEYIQ------------------------------------RIRGLSG
2iwhB           NCRIAYIKQHFAHIESHLDKTPSEYIQ------------------------------------RIRGLSG
2awnD           ----------------------------------------------------------------------
2d3wD           GIFMAFYPVEIPGVNQFFLQTALNAVRS--YRGQETLDRFDFQDLMEEKIAL--LKMPEDRSVNVG-FSG
1e69A           ------------------------------------------------------------RDQKLSLLSG
2d3wC           GIFMAFYPVEIPGVNQFFLQTALNAVRS--YRGQETLDRFDFQDLMEEKIAL--LKMPEDRSVNVG-FSG
2d3wB           GIFMAFYPVEIPGVNQFFLQTALNAVRS--YRGQETLDRFDFQDLMEEKIAL--LKMPEDRSVNVG-FSG


                         +         .         .         .         .         *         .:210
query           GQKQRAVIARMFASDPDVFILDEPTTGMDAGSKNEFYELMHHSAHHHGKAVLMITHDPEEVKDYADRNIH
2nq2C           GQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAIANKTLL
2nq2D           GQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAIANKTLL
3fvqB           GXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADR---
3fvqA           GXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADR---
2it1B           GQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADR---
2it1A           GQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADR---
2yz2B           GEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIV-EKWKTLGKTVILISHDIETVINHVDRVVV
2yz2A           GEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIV-EKWKTLGKTVILISHDIETVINHVDRVVV
3bk7A           GELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRLI-
3gfoA           GQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLL------------------------------
1l2tB           GQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHD-INVARFGERIIY
1l2tA           GQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHD-INVARFGERIIY
2yyzA           GQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASR---
1oxvA           GQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR---
1oxsC           GQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR---
3dhwC           GQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICD----
3d31A           GEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARIMADR---
1sgwA           GTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKG---IVIISSREEL-SYCDVNEN
1pf4A           GQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDEL--QKNKTVLVIAH--------------
1jj7A           GQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLIT---------------
1g291           GQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDR---
1xmiB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
1vplA           GMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKIL-KQASQEGLTILVSSHNMLEVEFLCDR-IA
2hydA           GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEAL------------------------------
1yqtA           GELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRH-LEKNEKTALVVEHD-------------
2oljA           GQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLA-NEGMTMVVVTHEMGFAREVGDR---
2oukB           GQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLA-NEGMTMVVVTHEMGFAREVGDR---
2pzfA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
2pcjA           GEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIF-LKINEGGTSIVMVTHERE-----------
1f3oA           GQQQRVAIARALANNPPIILADEPTGALDS-KTGEKIQLLKKLNEEDGKTVVVVTHD-INVARFGERIIY
2ixfC           GQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITH--------------
2ixfA           GQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITH--------------
2awoC           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
1xmiD           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
1q12A           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2ixfD           GQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITH--------------
3fh6A           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2awoA           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2awnB           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2pzgA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
2pzfB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
2pzeB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
2pzeA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
1ji0A           GEQQLAIGRAL--SRPK--LLDEPSLGLAPILVSEVFEVI-QKINQEGTTILLV----------------
1xmiE           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
1xmiC           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
1xmiA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
1gajA           GQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLA---HDIFNHVLELKAKGILIIEHRLDIVLNYID----
1g6hA           GQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLA---HDIFNHVLELKAKGILIIEHRLDIVLNYID----
2r6gB           GQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2r6gA           GQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2ghiA           GERQRIAIARCLLKDPKIVIFDEATSSLD--SKTEY----------------------------------
1g9xA           GQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLA---HDIFNHVLELKAKGILIIEHRLDIVLNYID----
3g60A           GQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKA--REGRTCIVIAH--------------
3g5uA           GQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKA--REGRTCIVIAH--------------
2pzgB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
2awnC           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2d62A           GQRQRVALGRAIIRRPKVF-LDEPLSNLDAKLRVKRAEL-KKLQRQLGVTTIYVTHDQVE----------
1mt0A           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC--KGRTVIIIAHRLSTVKN-ADRII-
2ff7A           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC--KGRTVIIIAHRLSTVKN-ADRII-
2ixeA           GQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLIT---------------
2bbsA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
2fgkA           GQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKIC--KGRTVIIIAHRLSTVKN-ADRII-
2ffbA           GQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKIC--KGRTVIIIAHRLSTVKN-ADRII-
3b5jA           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC--KGRTVIIIAHRLSTVKN-ADRII-
2bbtB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
2ghiB           GERQRIAIARCLLKDPKIVIFDEAT----SDSKTEY----------------------------------
2bbtA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
1xmjA           GQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
2ixeD           GQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLIT---------------
2cbzA           GQKQRVSLARAVYSNADIYLFDDPLSAVDAHGKHIFENVIGPKGMLKNKTRILVTH--------------
2bboA           GQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
1xf9D           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1xf9C           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1xf9B           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1xf9A           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1b0uA           GQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLA-EEGKTMVVVTHE-------------
1xefA           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC--KGRTVIIIAARLSTVKN-ADRII-
1v43A           GXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAV
2ffaA           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC--KGRTVIIIAARLSTVKN-ADRII-
2onkA           GERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLAD----
2ghiD           GERQRIAIARCLLKDPKIVIFDDSKT-----------EYLFQKAVEDNRTLIIIAH--------------
2bbsB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE--------------------------------
1xfaA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
2ixgA           GQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLIT---------------
1r10A           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0zD           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0zC           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0zB           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0zA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0xD           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0xC           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0xB           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0xA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0wC           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0wB           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1r0wA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1q3hD           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1q3hC           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1q3hB           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
1q3hA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFE--------------------------------
2ghiC           GERQRIAIARCLLKDPKIVIFDEATSSLD--SKTEY----------------------------------
1mv5D           GQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKAL--DSLMKGRTTLVIAHRLSTIVD-ADKIYF
1mv5A           GQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKAL--DSLMKGRTTLVIAHRLSTIVD-ADKIYF
1oxxK           XXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR---
2pjzA           GQSVLVRTSLALASQPEIVGLDEPFENVDAARRH----VISRYIKEYGKEGILVTHELDMLNLYKE----
2ihyB           GEKQR-VIARALGQ-PQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEI---------
1z47B           GXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADR---
1z47A           GXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADR---
1ii8B           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQ-VILVSHD-EELKDAADHVIR
1f2uD           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQ-VILVSHD-EELKDAADHVIR
1f2uB           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQ-VILVSHD-EELKDAADHVIR
1f2tB           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQ-VILVSHD-EELKDAADHVIR
2ix8A           GQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLG----ALSKALKEFEGGVIIITHSAEFTKNLTE----
2iw3B           GQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLG----ALSKALKEFEGGVIIITHSAEFTKNLTE----
2iw3A           GQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLG----ALSKALKEFEGGVIIITHSAEFTKNLTE----
2awnA           -------IGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2zu0C           GEKKRNDILQMAVLEPELCILDESDSGLD-----------------------------------------
2d3wA           GEKKRNDILQMAVLEPELCILDESDSGLD-----------------------------------------
1us8B           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQ-VILVSHD-EELKDAADHVIR
2r6fB           GEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRLV-DNGDTVLVIEHNLDVIK--------
2r6fA           GEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRLV-DNGDTVLVIEHNLDVIK--------
2ihyA           GEKQR-VIARALGQ-PQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEI---------
2ix3A           GQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLG----ALSKALKEFEGGVIIITHSAEFTKNLTE----
2iwhB           GQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLG----ALSKALKEFEGGVIIITHSAEFTKNLTE----
2awnD           --------------EPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2d3wD           GEKKRNDILQMAVLEPELCILDE-SDGLD-----------------------------------------
1e69A           GEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKH--TQFIVITHN-------------
2d3wC           GEKKRNDILQMAVLEPELCILDE-----------------------------------------------
2d3wB           GEKKRNDILQMAVLEPELCILDE-----------------------------------------------


                         .         .         .         +         .         .         .:280
query           LVRNQxxxxxxxxxxxxxxxxxxx
2nq2C           L-----------------------
2nq2D           L-----------------------
3fvqB           ------------------------
3fvqA           ------------------------
2it1B           ------------------------
2it1A           ------------------------
2yz2B           LEKGK-------------------
2yz2A           LEKGK-------------------
3bk7A           ------------------------
3gfoA           ------------------------
1l2tB           L-----------------------
1l2tA           L-----------------------
2yyzA           ------------------------
1oxvA           ------------------------
1oxsC           ------------------------
3dhwC           ------------------------
3d31A           ------------------------
1sgwA           L-----------------------
1pf4A           ------------------------
1jj7A           ------------------------
1g291           ------------------------
1xmiB           ------------------------
1vplA           LIHN--------------------
2hydA           ------------------------
1yqtA           ------------------------
2oljA           ------------------------
2oukB           ------------------------
2pzfA           ------------------------
2pcjA           ------------------------
1f3oA           L-----------------------
2ixfC           ------------------------
2ixfA           ------------------------
2awoC           L-----------------------
1xmiD           ------------------------
1q12A           L-----------------------
2ixfD           ------------------------
3fh6A           L-----------------------
2awoA           L-----------------------
2awnB           L-----------------------
2pzgA           ------------------------
2pzfB           ------------------------
2pzeB           ------------------------
2pzeA           ------------------------
1ji0A           ------------------------
1xmiE           ------------------------
1xmiC           ------------------------
1xmiA           ------------------------
1gajA           ------------------------
1g6hA           ------------------------
2r6gB           L-----------------------
2r6gA           L-----------------------
2ghiA           ------------------------
1g9xA           ------------------------
3g60A           ------------------------
3g5uA           ------------------------
2pzgB           ------------------------
2awnC           L-----------------------
2d62A           ------------------------
1mt0A           ------------------------
2ff7A           ------------------------
2ixeA           ------------------------
2bbsA           ------------------------
2fgkA           ------------------------
2ffbA           ------------------------
3b5jA           ------------------------
2bbtB           ------------------------
2ghiB           ------------------------
2bbtA           ------------------------
1xmjA           ------------------------
2ixeD           ------------------------
2cbzA           ------------------------
2bboA           ------------------------
1xf9D           ------------------------
1xf9C           ------------------------
1xf9B           ------------------------
1xf9A           ------------------------
1b0uA           ------------------------
1xefA           ------------------------
1v43A           MNRGQ-------------------
2ffaA           ------------------------
2onkA           ------------------------
2ghiD           ------------------------
2bbsB           ------------------------
1xfaA           ------------------------
2ixgA           ------------------------
1r10A           ------------------------
1r0zD           ------------------------
1r0zC           ------------------------
1r0zB           ------------------------
1r0zA           ------------------------
1r0xD           ------------------------
1r0xC           ------------------------
1r0xB           ------------------------
1r0xA           ------------------------
1r0wC           ------------------------
1r0wB           ------------------------
1r0wA           ------------------------
1q3hD           ------------------------
1q3hC           ------------------------
1q3hB           ------------------------
1q3hA           ------------------------
2ghiC           ------------------------
1mv5D           IEKGQ-------------------
1mv5A           IEKGQ-------------------
1oxxK           ------------------------
2pjzA           ------------------------
2ihyB           ------------------------
1z47B           ------------------------
1z47A           ------------------------
1ii8B           I-----------------------
1f2uD           I-----------------------
1f2uB           I-----------------------
1f2tB           I-----------------------
2ix8A           ------------------------
2iw3B           ------------------------
2iw3A           ------------------------
2awnA           L-----------------------
2zu0C           ------------------------
2d3wA           ------------------------
1us8B           I-----------------------
2r6fB           ------------------------
2r6fA           ------------------------
2ihyA           ------------------------
2ix3A           ------------------------
2iwhB           ------------------------
2awnD           L-----------------------
2d3wD           ------------------------
1e69A           ------------------------
2d3wC           ------------------------
2d3wB           ------------------------