[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55904.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1euhA.bssp"
#ERROR : Can't open dsspfile "2id2C.bssp"
#ERROR : Can't open dsspfile "2id2A.bssp"
#ERROR : Can't open dsspfile "2esdA.bssp"
#ERROR : Can't open dsspfile "1qi1A.bssp"
#ERROR : Can't open dsspfile "3ifgA.bssp"
#ERROR : Can't open dsspfile "1ky8A.bssp"
#ERROR : Can't open dsspfile "1uxvA.bssp"
#ERROR : Can't open dsspfile "1uxnA.bssp"
#ERROR : Can't open dsspfile "1bxsA.bssp"
#ERROR : Can't open dsspfile "2ve5A.bssp"
#ERROR : Can't open dsspfile "1bi9D.bssp"
#ERROR : Can't open dsspfile "1bi9C.bssp"
#ERROR : Can't open dsspfile "1bi9B.bssp"
#ERROR : Can't open dsspfile "1bi9A.bssp"
#ERROR : Can't open dsspfile "1a4sA.bssp"
#ERROR : Can't open dsspfile "1o9jA.bssp"
#ERROR : Can't open dsspfile "2ve5C.bssp"
#ERROR : Can't open dsspfile "2onnA.bssp"
#ERROR : Can't open dsspfile "1o02A.bssp"
#ERROR : Can't open dsspfile "1o01C.bssp"
#ERROR : Can't open dsspfile "1t90A.bssp"
#ERROR : Can't open dsspfile "2opxA.bssp"
#ERROR : Can't open dsspfile "1o04A.bssp"
#ERROR : Can't open dsspfile "2hg2A.bssp"
#ERROR : Can't open dsspfile "2iluA.bssp"
#ERROR : Can't open dsspfile "3b4wA.bssp"
#ERROR : Can't open dsspfile "2onmA.bssp"
#ERROR : Can't open dsspfile "1a4zA.bssp"
#ERROR : Can't open dsspfile "3fg0E.bssp"
#ERROR : Can't open dsspfile "3fg0D.bssp"
#ERROR : Can't open dsspfile "3fg0C.bssp"
#ERROR : Can't open dsspfile "3fg0A.bssp"
#ERROR : Can't open dsspfile "3ed6A.bssp"
#ERROR : Can't open dsspfile "2o2pA.bssp"
#ERROR : Can't open dsspfile "3ek1G.bssp"
#ERROR : Can't open dsspfile "3ek1B.bssp"
#ERROR : Can't open dsspfile "3ek1A.bssp"
#ERROR : Can't open dsspfile "2w8nA.bssp"
#ERROR : Can't open dsspfile "2w8pA.bssp"
#ERROR : Can't open dsspfile "1zumA.bssp"
#ERROR : Can't open dsspfile "2j6lB.bssp"
#ERROR : Can't open dsspfile "2j6lA.bssp"
#ERROR : Can't open dsspfile "2bhpA.bssp"
#ERROR : Can't open dsspfile "1uzbA.bssp"
#ERROR : Can't open dsspfile "2w8oA.bssp"
#ERROR : Can't open dsspfile "3i44A.bssp"
#ERROR : Can't open dsspfile "1zumD.bssp"
#ERROR : Can't open dsspfile "2bjaA.bssp"
#ERROR : Can't open dsspfile "1zumE.bssp"
#ERROR : Can't open dsspfile "1zumJ.bssp"
#ERROR : Can't open dsspfile "1zumC.bssp"
#ERROR : Can't open dsspfile "1zumL.bssp"
#ERROR : Can't open dsspfile "1zumI.bssp"
#ERROR : Can't open dsspfile "2d4eC.bssp"
#ERROR : Can't open dsspfile "2d4eA.bssp"
#ERROR : Can't open dsspfile "1zumB.bssp"
#ERROR : Can't open dsspfile "1wnbA.bssp"
#ERROR : Can't open dsspfile "2jg7A.bssp"
#ERROR : Can't open dsspfile "1zumK.bssp"
#ERROR : Can't open dsspfile "3etfD.bssp"
#ERROR : Can't open dsspfile "3etfC.bssp"
#ERROR : Can't open dsspfile "3etfB.bssp"
#ERROR : Can't open dsspfile "3efvC.bssp"
#ERROR : Can't open dsspfile "3efvA.bssp"
#ERROR : Can't open dsspfile "1ad3A.bssp"
#ERROR : Can't open dsspfile "3ju8A.bssp"
#ERROR : Can't open dsspfile "2vroB.bssp"
#ERROR : Can't open dsspfile "2vroA.bssp"
#ERROR : Can't open dsspfile "1eyyB.bssp"
#ERROR : Can't open dsspfile "1eyyA.bssp"
#ERROR : Can't open dsspfile "1co3B.bssp"
#ERROR : Can't open dsspfile "1co3A.bssp"
#ERROR : Can't open dsspfile "1o20A.bssp"

## Summary of PDB Search
:474
      0.0  69%  1euhA  [c.82.1] NADP DEPENDENT NON PHOSPHORYLATING
      0.0  69%  2id2C  [x.x.x] NADP-DEPENDENT GLYCERALDEHYDE-3-PHOSPHATE
      0.0  69%  2id2A  [x.x.x] NADP-DEPENDENT GLYCERALDEHYDE-3-PHOSPHATE
      0.0  69%  2esdA  [x.x.x] NADP-DEPENDENT GLYCERALDEHYDE-3-PHOSPHATE
      0.0  69%  1qi1A  [c.82.1] PROTEIN (NADP-DEPENDENT NONPHOSPHORYLATING
    1e-66  38%  3ifgA  [x.x.x] SUCCINATE-SEMIALDEHYDE DEHYDROGENASE (NADP+)
    2e-59  33%  1ky8A  [c.82.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    4e-59  33%  1uxvA  [c.82.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE (NADP+)
    6e-59  32%  1uxnA  [c.82.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE (NADP+)
    1e-58  36%  1bxsA  [c.82.1] ALDEHYDE DEHYDROGENASE
    1e-57  31%  2ve5A  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    3e-57  38%  1bi9D  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    3e-57  38%  1bi9C  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    3e-57  38%  1bi9B  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    3e-57  38%  1bi9A  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    3e-56  33%  1a4sA  [c.82.1] BETAINE ALDEHYDE DEHYDROGENASE
    5e-56  34%  1o9jA  [c.82.1] ALDEHYDE DEHYDROGENASE, CYTOSOLIC 1
    2e-55  31%  2ve5C  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    3e-55  33%  2onnA  [x.x.x] ALDEHYDE DEHYDROGENASE
    4e-55  33%  1o02A  [c.82.1] ALDEHYDE DEHYDROGENASE
    4e-55  33%  1o01C  [c.82.1] ALDEHYDE DEHYDROGENASE
    7e-55  31%  1t90A  [x.x.x] PROBABLE METHYLMALONATE-SEMIALDEHYDE
    4e-54  35%  2opxA  [x.x.x] ALDEHYDE DEHYDROGENASE A
    6e-54  33%  1o04A  [c.82.1] ALDEHYDE DEHYDROGENASE, MITOCHONDRIAL PRECURSOR
    6e-54  35%  2hg2A  [x.x.x] ALDEHYDE DEHYDROGENASE A
    2e-53  35%  2iluA  [x.x.x] ALDEHYDE DEHYDROGENASE A
    4e-53  37%  3b4wA  [x.x.x] ALDEHYDE DEHYDROGENASE
    7e-53  33%  2onmA  [x.x.x] ALDEHYDE DEHYDROGENASE, MITOCHONDRIAL PRECURSOR
    7e-53  32%  1a4zA  [c.82.1] ALDEHYDE DEHYDROGENASE
    3e-52  31%  3fg0E  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    3e-52  31%  3fg0D  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    3e-52  31%  3fg0C  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    3e-52  31%  3fg0A  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    3e-52  31%  3ed6A  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    6e-52  34%  2o2pA  [x.x.x] FORMYLTETRAHYDROFOLATE DEHYDROGENASE
    1e-51  31%  3ek1G  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-51  31%  3ek1B  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-51  31%  3ek1A  [x.x.x] ALDEHYDE DEHYDROGENASE
    6e-49  30%  2w8nA  [x.x.x] SUCCINATE-SEMIALDEHYDE DEHYDROGENASE,
    7e-48  30%  2w8pA  [x.x.x] SUCCINIC SEMIALDEHYDE DEHYDROGENASE
    9e-48  33%  1zumA  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-47  29%  2j6lB  [x.x.x] ALDEHYDE DEHYDROGENASE FAMILY 7 MEMBER A1
    3e-47  29%  2j6lA  [x.x.x] ALDEHYDE DEHYDROGENASE FAMILY 7 MEMBER A1
    3e-47  35%  2bhpA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    1e-46  35%  1uzbA  [c.82.1] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    2e-46  30%  2w8oA  [x.x.x] SUCCINIC SEMIALDEHYDE DEHYDROGENASE
    8e-46  31%  3i44A  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-45  33%  1zumD  [x.x.x] ALDEHYDE DEHYDROGENASE
    7e-45  35%  2bjaA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    2e-44  32%  1zumE  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-44  32%  1zumJ  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-44  33%  1zumC  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-44  33%  1zumL  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-44  32%  1zumI  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-42  35%  2d4eC  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    1e-42  35%  2d4eA  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    1e-42  32%  1zumB  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-41  29%  1wnbA  [c.82.1] PUTATIVE BETAINE ALDEHYDE DEHYDROGENASE
    1e-40  27%  2jg7A  [x.x.x] ANTIQUITIN
    1e-40  32%  1zumK  [x.x.x] ALDEHYDE DEHYDROGENASE
    6e-33  33%  3etfD  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    6e-33  33%  3etfC  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    6e-33  33%  3etfB  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    6e-33  33%  3efvC  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    6e-33  33%  3efvA  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    6e-33  31%  1ad3A  [c.82.1] ALDEHYDE DEHYDROGENASE (CLASS 3)
    1e-32  30%  3ju8A  [x.x.x] SUCCINYLGLUTAMIC SEMIALDEHYDE DEHYDROGENASE
    2e-16  29%  2vroB  [x.x.x] ALDEHYDE DEHYDROGENASE
    3e-15  28%  2vroA  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-09  24%  1eyyB  [c.82.1] ALDEHYDE DEHYDROGENASE
    2e-09  24%  1eyyA  [c.82.1] ALDEHYDE DEHYDROGENASE
    2e-09  24%  1co3B  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-09  24%  1co3A  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-05  26%  1o20A  [c.82.1] GAMMA-GLUTAMYL PHOSPHATE REDUCTASE
:474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTRYQNLVNGKWKSSEQEITIYSPINQEELGTVPAMTQTEXXXXXXXXXXXXXXXXXXXXIERAAYLHKT
1euhA           --QYKNYVNGEWKLSENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKV
2id2C           --QYKNYVNGEWKLSENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKV
2id2A           --QYKNYVNGEWKLSENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKV
2esdA           --QYKNYVNGEWKLSENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKV
1qi1A           --QYKNYVNGEWKLSENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKV
3ifgA           LLRHQAYIGGEWQAADSDATVFDPATGESLGTVPKMXXXXXXXXXXXXXXXXXXXXMKTAKERAAILRRW
1ky8A           ---YPSYLAGEWGGSGQEIEVKSPIDLATIAKVISPSREEVERTLDVLFKRGRWSARDMPTERLAVLRKA
1uxvA           ---YPSYLAGEWGGSGQEIEVKSPIDLATIAKVISPSREEVERTLDVLFKRGRWSARDMPTERLAVLRKA
1uxnA           ---YPSYLAGEWGGSGQEIEVKSPIDLATIAKVISPSREEVERTLDVLFKRGRWSARDMPTERLAVLRKA
1bxsA           -------------------------------------------------------------ERGRLLNKL
2ve5A           -------------SSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRA
1bi9D           -------------------------------------------------------------ERGRLLDKL
1bi9C           -------------------------------------------------------------ERGRLLDKL
1bi9B           -------------------------------------------------------------ERGRLLDKL
1bi9A           -------------------------------------------------------------ERGRLLDKL
1a4sA           ------------------------------------------------------------IERSRVMLEA
1o9jA           -------------------------------------------------------------ERGQLIYKL
2ve5C           -------------SSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRA
2onnA           --------------------------------------------------------------RGRLLNRL
1o02A           --------------------------------------------------------------RGRLLNRL
1o01C           --------------------------------------------------------------RGRLLNRL
1t90A           --KLKNYINGEWVESDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRARILFNF
2opxA           ------------------------------------------------------------IERASWLRKI
1o04A           --------------------------------------------------------------RGRLLNRL
2hg2A           ------------------------------------------------------------IERASWLRKI
2iluA           ------------------------------------------------------------IERASWLRKI
3b4wA           ----------------------------------------------------------------------
2onmA           --------------------------------------------------------------RGRLLNRL
1a4zA           -------------------------------------------------------------ERGRLLNRL
3fg0E           -------IDGEWVESANKNTIINPYNQEVIFTVSEGTKAERAILAARRAFESGEWSQETAETRGKKVRAI
3fg0D           -------IDGEWVESANKNTIINPYNQEVIFTVSEGTKAERAILAARRAFESGEWSQETAETRGKKVRAI
3fg0C           -------IDGEWVESANKNTIINPYNQEVIFTVSEGTKAERAILAARRAFESGEWSQETAETRGKKVRAI
3fg0A           -------IDGEWVESANKNTIINPYNQEVIFTVSEGTKAERAILAARRAFESGEWSQETAETRGKKVRAI
3ed6A           -------IDGEWVESANKNTIINPYNQEVIFTVSEGTKAERAILAARRAFESGEWSQETAETRGKKVRAI
2o2pA           -------------------------------------------------------------DRGRLLYRL
3ek1G           LLKSQCLVNGRWIDAADGTTIKNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKW
3ek1B           LLKSQCLVNGRWIDAADGTTIKNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKW
3ek1A           LLKSQCLVNGRWIDAADGTTIKNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKW
2w8nA           LLRTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGXXXXXXXXXXXXXXFCRWREVSAKERSSLLRKW
2w8pA           LLRTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGXXXXXXXXXXXXXXFCRWREVSAKERSSLLRKW
1zumA           --------------------------------------------------------------RGRLLNRL
2j6lB           ----EGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQI
2j6lA           ----EGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQI
2bhpA           ----------------------------------------------------------------------
1uzbA           ----------------------------------------------------------------------
2w8oA           LLRTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGXXXXXXXXXXXXXXFCRWREVSAKERSSLLRKW
3i44A           -------INGLWDSTPHDLYVIDPSTEEACAVISLGSTRXXXXXXXXXXXXFQTWKTTSPHERLGFVEKI
1zumD           --------------------------------------------------------------RGRLLNRL
2bjaA           ----------------------------------------------------------------------
1zumE           --------------------------------------------------------------RGRLLNRL
1zumJ           --------------------------------------------------------------RGRLLNRL
1zumC           --------------------------------------------------------------RGRLLNRL
1zumL           --------------------------------------------------------------RGRLLNRL
1zumI           --------------------------------------------------------------RGRLLNRL
2d4eC           ----------------------------------------------------------------------
2d4eA           ----------------------------------------------------------------------
1zumB           --------------------------------------------------------------RGRLLNRL
1wnbA           --------------------------------------------------------------RAECLLKL
2jg7A           --------NGSWGGSGEVITSYCPANNEPIARVTQATLAEYEETVQKTREAWKMWADIPAPKRGEIVRQI
1zumK           --------------------------------------------------------------RGRLLNRL
3etfD           -------------------------------------------------------------QRAQTLRDI
3etfC           -------------------------------------------------------------QRAQTLRDI
3etfB           -------------------------------------------------------------QRAQTLRDI
3efvC           -------------------------------------------------------------QRAQTLRDI
3efvA           -------------------------------------------------------------QRAQTLRDI
1ad3A           ----------------------------------------------------------------------
3ju8A           -------------------------------------------------------------QRIELLERF
2vroB           ----------------------------------------------------------------------
2vroA           ----------------------------------------------------------------------
1eyyB           -------------------------------------------------------------KRASLLRTI
1eyyA           -------------------------------------------------------------KRASLLRTI
1co3B           -------------------------------------------------------------KRASLLRTI
1co3A           -------------------------------------------------------------KRASLLRTI
1o20A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AAILERDKEKIGTILAKEVAKGIKAAIGEVVRTADLIRYAAEEGXRITGQAMEGGGFEAASKNKLAVVRR
1euhA           ADILMRDKEKIGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEAASKKKIAVVRR
2id2C           ADILMRDKEKIGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEAASKKKIAVVRR
2id2A           ADILMRDKEKIGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEAASKKKIAVVRR
2esdA           ADILMRDKEKIGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEAASKKKIAVVRR
1qi1A           ADILMRDKEKIGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEAASKKKIAVVRR
3ifgA           FDLVIANSDDLALILTTEQGKPLAEAKGEIAYAASFIEWFAEEGKRVAGDTLP-----TPDANKRIVVVK
1ky8A           ADIIERNLDVFAEVLVMNAGKPKSAAVGEVKAAVDRLRLAELDLKKIGGDYIPGDWTYDTLETE-GLVRR
1uxvA           ADIIERNLDVFAEVLVMNAGKPKSAAVGEVKAAVDRLRLAELDLKKIGGDYIPGDWTYDTLETE-GLVRR
1uxnA           ADIIERNLDVFAEVLVMNAGKPKSAAVGEVKAAVDRLRLAELDLKKIGGDYIPGDWTYDTLETE-GLVRR
1bxsA           ADLIERDRLLLATMEAMNGGKLFSNALGGCIKT---LRYCAGWADKIQGRTIPMDG------NFFTYTRS
2ve5A           VDILRERNDELAALETLDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIP------LRETSFVYTRR
1bi9D           ADLVERDRATLATMESLNGGKPFLQALQGVIKT---LRYYAGWADKIHGMTIPVDG------DYFTFTRH
1bi9C           ADLVERDRATLATMESLNGGKPFLQALQGVIKT---LRYYAGWADKIHGMTIPVDG------DYFTFTRH
1bi9B           ADLVERDRATLATMESLNGGKPFLQALQGVIKT---LRYYAGWADKIHGMTIPVDG------DYFTFTRH
1bi9A           ADLVERDRATLATMESLNGGKPFLQALQGVIKT---LRYYAGWADKIHGMTIPVDG------DYFTFTRH
1a4sA           ARIIRERRDNIAKLEVINNGKTITEAEYDIDAAWQCIEYYAGLAPTLSGQHIQGGAF--------AYTRR
1o9jA           ADLIERDRLLLATLESINAGKVFASALMDLDYCIKALRYCAGWADKIQGRTIPVDG------EFFSYTRH
2ve5C           VDILRERNDELAALETLDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIP------LRETSFVYTRR
2onnA           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
1o02A           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
1o01C           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
1t90A           QQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLASIATDVEAANY-----R
2opxA           SAGIRERATEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQS---DRPGENILLFKRA
1o04A           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
2hg2A           SAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQS---DRPGENILLFKRA
2iluA           SAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQS---DRPGENILLFKRA
3b4wA           -----------------------------------------------------------------SIVSR
2onmA           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
1a4zA           ADLIERDRTYLAALETLDNGKPIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DYFSYTRH
3fg0E           ADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESK-----IVK
3fg0D           ADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESK-----IVK
3fg0C           ADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESK-----IVK
3fg0A           ADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESK-----IVK
3ed6A           ADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESK-----IVK
2o2pA           ADVMEQHQEELATIEALDAGAALKTHVGMSIQT---FRYFAGWCDKIQGATIPIN--QARPNRNLTLTKK
3ek1G           FXXXXXXXXXXXXXMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIP-----APQNGQRLTVIR
3ek1B           FXXXXXXXXXXXXXMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIP-----APQNGQRLTVIR
3ek1A           FXXXXXXXXXXXXXMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIP-----APQNGQRLTVIR
2w8nA           YNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH-----TPAKDRRALVLK
2w8pA           YNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH-----TPAKDRRALVLK
1zumA           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
2j6lB           GDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYA------VGLSRMIGGPILPSERSGHALIEQ
2j6lA           GDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYA------VGLSRMIGGPILPSERSGHALIEQ
2bhpA           ----------------------------------------------------------------------
1uzbA           ----------------------------------------------------------------------
2w8oA           YNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH-----TPAKDRRALVLK
3i44A           LEIYEKRSSDMAKTISMEMGAPIDMALNAQTATGS-------SHIRNFIKAYKEFSFQEAEGNEQAILHY
1zumD           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
2bjaA           ----------------------------------------------------------------------
1zumE           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
1zumJ           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
1zumC           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
1zumL           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
1zumI           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
2d4eC           ---------------------------------------------------------------------R
2d4eA           ---------------------------------------------------------------------R
1zumB           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
1wnbA           ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
2jg7A           GDALRKKIKVLGSLVSLEMGKIXXXXXXXXXXXXXXCDYAVGLSRMIGGPVLP-----SERPGHALIEQW
1zumK           ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
3etfD           GQALRAHAEEAQCITRE--GKPIKQARAEVTKSAALCDWYAEHGPALNPEP-------TLVENQQAVIEY
3etfC           GQALRAHAEEAQCITRE--GKPIKQARAEVTKSAALCDWYAEHGPALNPEP-------TLVENQQAVIEY
3etfB           GQALRAHAEEAQCITRE--GKPIKQARAEVTKSAALCDWYAEHGPALNPEP-------TLVENQQAVIEY
3efvC           GQALRAHAEEAQCITRE--GKPIKQARAEVTKSAALCDWYAEHGPALNPEP-------TLVENQQAVIEY
3efvA           GQALRAHAEEAQCITRE--GKPIKQARAEVTKSAALCDWYAEHGPALNPEP-------TLVENQQAVIEY
1ad3A           -------------------------------------------------------------------IHS
3ju8A           AATLKSRADELARVIGEETGKPLWESATEVT-SVNKVAISVQAFRERTGE--KSGPLADAT----AVLRH
2vroB           --------------------------------------------------ALRDGSAESLSKDRSFSAQH
2vroA           --------------------------------------------------ALRDGSAESLSKDRSFSAQH
1eyyB           ASELEARSDDIIARAHLETALPEVRLTGEIARTANQLRLFADV---VNSGSYHQAILDTPNPTRAPLIRR
1eyyA           ASELEARSDDIIARAHLETALPEVRLTGEIARTANQLRLFADV---VNSGSYHQAILDTPNPTRAPLIRR
1co3B           ASELEARSDDIIARAHLETALPEVRLTGEIARTANQLRLFADV---VNSGSYHQAILDTPNPTRAPLIRR
1co3A           ASELEARSDDIIARAHLETALPEVRLTGEIARTANQLRLFADV---VNSGSYHQAILDTPNPTRAPLIRR
1o20A           ---LALNDKRIDEIKACETVIGLKDPVGEVIDS-----WVREDGLRIARVRVPIG---------------


                         +         .         .         .         .         *         .:210
query           EPVGIVLAIAPFNYPVNLSASKIAPALIAGNVVMFKPPTQGSISGLLLAKAFEEAGIPAGVFNTITGRGS
1euhA           EPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGS
2id2C           EPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGS
2id2A           EPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGS
2esdA           EPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGS
1qi1A           EPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGS
3ifgA           EPIGVCAAITPWNFPAAMIARKVGPALAAGCPIVVKPAESTPFSALAMAFLAERAGVPKGVLSVVIGDPK
1ky8A           EPLGVVAAITPFNYPLFDAVNKITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPGK
1uxvA           EPLGVVAAITPFNYPLFDAVNKITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPGK
1uxnA           EPLGVVAAITPFNYPLFDAVNKITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPGK
1bxsA           EPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPGYGP
2ve5A           EPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGR
1bi9D           EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
1bi9C           EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
1bi9B           EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
1bi9A           EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
1a4sA           EPLGVCAGILAWNYPFMIAAWKCAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQG-GA
1o9jA           EPIGVCGLIFPWNAPMILLACKIGPALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGP
2ve5C           EPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGR
2onnA           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
1o02A           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
1o01C           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
1t90A           YPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLVELFEKAGLPKGVFNVVYG-AH
2opxA           --LGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGE
1o04A           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
2hg2A           --LGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGE
2iluA           --LGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGE
3b4wA           EPVGVVGAIVAWNVPLFLAVNKIAPALLAGCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPG-GI
2onmA           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
1a4zA           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNVIPGFGP
3fg0E           EPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGS
3fg0D           EPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGS
3fg0C           EPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGS
3fg0A           EPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGS
3ed6A           EPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGS
2o2pA           EPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGS
3ek1G           QPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRXXXXXXXXXXXXGVLAEKAGIPAGVLQIVTGKAR
3ek1B           QPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRXXXXXXXXXXXXGVLAEKAGIPAGVLQIVTGKAR
3ek1A           QPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRXXXXXXXXXXXXGVLAEKAGIPAGVLQIVTGKAR
2w8nA           QPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIRKNAK
2w8pA           QPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIRKNAK
1zumA           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
2j6lB           NPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKAPTTSLISVAIIAKVLEDNKLP-GAICSLTCGGA
2j6lA           NPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKAPTTSLISVAIIAKVLEDNKLP-GAICSLTCGGA
2bhpA           -PLGAGVVIAPWNFPVAIFTGMIVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGE
1uzbA           -PLGAGVVIAPWNFPVAIFTGMIVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGE
2w8oA           QPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSXXXXXXXXSQAGIPSGVYNVIRKNAK
3i44A           DAIGVVGLITPWNWPMNQVTLKVIPALLAGCTMVLKPSEIAPLSAMLFAEILDEAALPSGVFNLINGDGA
1zumD           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
2bjaA           -PLGAGVVIAPWNFPVAIFTGMIVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGE
1zumE           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
1zumJ           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
1zumC           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
1zumL           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
1zumI           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
2d4eC           VPAGPVGIITPWNAPLMLSTWRIAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGE
2d4eA           VPAGPVGIITPWNAPLMLSTWRIAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGE
1zumB           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
1wnbA           DPLGVVASIAPWNYXXXXXXXXXXXXXXXGNCVVLKPSEITPLTALKLAELAKDI-FPAGVVNILFGRGK
2jg7A           NPVGLVGIITAFNFPVAVYGWNNAIALTCGNVCLWKGAPTTPLTSVIVAEVLEQNNLPGAICSMTCG-GA
1zumK           EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
3etfD           RPLGVILAI-PWNFPLWQVLRGAVPILLAGNSYLLKPNVTGCAQ---IARILAEAGTPAGVYGWVNANNE
3etfC           RPLGVILAI-PWNFPLWQVLRGAVPILLAGNSYLLKPNVTGCAQ---IARILAEAGTPAGVYGWVNANNE
3etfB           RPLGVILAI-PWNFPLWQVLRGAVPILLAGNSYLLKPNVTGCAQ---IARILAEAGTPAGVYGWVNANNE
3efvC           RPLGVILAI-PWNFPLWQVLRGAVPILLAGNSYLLKPNVTGCAQ---IARILAEAGTPAGVYGWVNANNE
3efvA           RPLGVILAI-PWNFPLWQVLRGAVPILLAGNSYLLKPNVTGCAQ---IARILAEAGTPAGVYGWVNANNE
1ad3A           EPLGVVLVIGAWNYPFNLTIQPMVGAVAAGNAVILKPSEVSGHMADLLATLIPQY-MDQNLYLVVKGGVP
3ju8A           KPHGVVAVFGPYNFPGHLPNGHIVPALLAGNCVVFKPSELTPKVAELTLKAWIQAGLPAGVLNLVQG-GR
2vroB           SPTGVALFINAFNFPSWGLWEKAAPALLSGVPVIVKPATATALTQRMVADVVDAGILPPGALSIICGSSA
2vroA           SPTGVALFINAFNFPSWGLWEKAAPALLSGVPVIVKPATATALTQRMVADVVDAGILPPGALSIICGSSA
1eyyB           QQIGPVAVFGASNFPLAFSXXXXCPVIVKGHTAH---PGTSQIVAECIEQALKQEQLPQAIFTLLQGNQR
1eyyA           QQIGPVAVFGASNFPLAFSXXXXCPVIVKGHTAH---PGTSQIVAECIEQALKQEQLPQAIFTLLQGNQR
1co3B           QQIGPVAVFGASNFPLAFSXXXXCPVIVKGHTAH---PGTSQIVAECIEQALKQEQLPQAIFTLLQGNQR
1co3A           QQIGPVAVFGASNFPLAFSXXXXCPVIVKGHTAH---PGTSQIVAECIEQALKQEQLPQAIFTLLQGNQR
1o20A           -PIGIIYESRP-----NVTVETTILALKSGNTILLRGGSDALNSNKAIVSAIREAEIPESSVEFIENTDR


                         .         .         .         +         .         .         .:280
query           EIGDYIIEHKEVNFINFTGSTPIGERIGRLAGMRPIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSG
1euhA           EIGDYIVEHQAVNFINFTGSTGIGERIGKMAGMRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSG
2id2C           EIGDYIVEHQAVNFINFSGSTGIGERIGKMAGMRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSG
2id2A           EIGDYIVEHQAVNFINFSGSTGIGERIGKMAGMRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSG
2esdA           EIGDYIVEHQAVNFINFTGSTGIGERIGKMAGMRPIMLALGGKDSAIVLEDADLELTAKNIIAGAFGYSG
1qi1A           EIGDYIVEHQAVNFINFTGSTGIGERIGKMAGMRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSG
3ifgA           AIGTEITSNPIVRKLSFTGSTAVGRLLMAQSAVKKLTLELGGNAPFIVFDDADLDAAVEGAIASKYRNNG
1ky8A           E-AEKIVADDRVAAVSFTGSTXXXXXXXXXXXXXQYVMELGGGDPAIVXXXXXXXXXXXKIARGIYSYAG
1uxvA           E-AEKIVADDRVAAVSFTGSTXXXXXXXXXXXXXQYVMELGGGDPAIVXXXXXXXXXXXKIARGIYSYAG
1uxnA           E-AEKIVADDRVAAVSFTGSTXXXXXXXXXXXXXQYVMELGGGDPAIVXXXXXXXXXXXKIARGIYSYAG
1bxsA           TAGAAISSHMDVDKVAFTGSTEVGKLIKEAAGLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQG
2ve5A           EVGQWLTEHPLIEKISFTGGTSTGKKVASSSSLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSG
1bi9D           TAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
1bi9C           TAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
1bi9B           TAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
1bi9A           TAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
1a4sA           ETGSLLCHHPNVAKVSFTGSVPTGKKVMEMSAVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQG
1o9jA           TAGAAISSHMDVDKVAFTGSTEVGKMIQEAANLKRVTLELGAKNPCIVFADADLDSAVEFAHQGVFTNQG
2ve5C           EVGQWLTEHPLIEKISFTGGTSTGKKVASSSSLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSG
2onnA           TAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1o02A           TAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1o01C           TAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1t90A           DVVNGILEHPEIKAISFVGSKPVGEYVYKKGSLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAG
2opxA           TVGQELAGNPKVAMVSMTGSVSAGEKIMATANITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSG
1o04A           TAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
2hg2A           TVGQELAGNPKVAMVSMTGSVSAGEKIMATANITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSG
2iluA           TVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNTKVLELGGKAPAIVMDDADLELAVKAIVDSRVINSG
3b4wA           ETGQALTSNPDIDMFTFTGSSAVGREVGRRAALKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAG
2onmA           TAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1a4zA           TAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGLKRVTLEIGGKSPNIIMSDADMDWAVEQAHFALFFNQG
3fg0E           EVGDVMSGHKEVDLVSFTGGIETGKHIMKNANVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAG
3fg0D           EVGDVMSGHKEVDLVSFTGGIETGKHIMKNANVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAG
3fg0C           EVGDVMSGHKEVDLVSFTGGIETGKHIMKNANVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAG
3fg0A           EVGDVMSGHKEVDLVSFTGGIETGKHIMKNANVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAG
3ed6A           EVGDVMSGHKEVDLVSFTGGIETGKHIMKNANVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAG
2o2pA           LVGQRLSDHPDVRKIGFTGSTEVGKHIMKLSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKG
3ek1G           EIGAELTSNDTVRKLSFTGSTEVGRLLMAQCAIKRISLELGGNAPFIVFXXXXXXXXXXXXMVSKYRNAG
3ek1B           EIGAELTSNDTVRKLSFTGSTEVGRLLMAQCAIKRISLELGGNAPFIVFXXXXXXXXXXXXMVSKYRNAG
3ek1A           EIGAELTSNDTVRKLSFTGSTEVGRLLMAQCAIKRISLELGGNAPFIVFXXXXXXXXXXXXMVSKYRNAG
2w8nA           EVGEAICTDPLVSKISFTGSTTTGKILLHHASVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTG
2w8pA           EVGEAICTDPLVSKISFTGSTTTGKILLHHASVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTG
1zumA           TAGAAIASHEDVDKVAFTGST----EIGRVIQVARVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
2j6lB           DIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAG
2j6lA           DIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAG
2bhpA           EVGAYLVEHPRIRFINFTGSLEVGEAAGRLAWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQG
1uzbA           EVGAYLVEHPRIRFINFTGSLEVGEAAGRLAWFKRAYVETGGKNAIIVDETADFDLAAEGVVVSAYGFQG
2w8oA           EVGEAICTDPLVSKISFTGSTTTGKILLHHASVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTG
3i44A           NVGSYLSAHPDLEMISFTGSTRAGKDISKNASLKRVCLELGGKGANXXXXXXXXXXLQRG-VRHCFYNSG
1zumD           TAGAAIASHEDVDKVAFTGST-------------RVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
2bjaA           EVGAYLVEHPRIRFINFTGSLEVGEAAGRLAWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQG
1zumE           TAGAAIASHEDVDKVAFTG--------------KRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1zumJ           TAGAAIASHEDVDKVAFTGR---------------VTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1zumC           TAGAAIASHEDVDKVAFTG--------------KRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1zumL           TAGAAIASHEDVDKVAFTRVT----------------LELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1zumI           TAGAAIASHEDVDKVAFTGR---------------VTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
2d4eC           EAGAXXXXXXXXXXXXXXXXXXXXKIVMRNAALKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNG
2d4eA           EAGAXXXXXXXXXXXXXXXXXXXXKIVMRNAALKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNG
1zumB           TAGAAIASHEDVDKVAF------------------VTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
1wnbA           TVGDPLTGHPKVRMVSLTGSIATGEHIHTASSIKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAG
2jg7A           DIGTAMAKDERVDLLSFTGSTHVGKMVAMMVQERRKLLELGGNNAIIVFEDADLNLVVPSAVFASVGTAG
1zumK           TAGAAIASHEDVDKVAFTGKSP-----------------------NIIMSDADMDWAVEQAHFALFFNQG
3etfD           GVSQ--INDPRIAAVTVTGSVXXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTG
3etfC           GVSQ--INDPRIAAVTVTGSVXXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTG
3etfB           GVSQ--INDPRIAAVTVTGSVXXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTG
3efvC           GVSQ--INDPRIAAVTVTGSVXXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTG
3efvA           GVSQ--INDPRIAAVTVTGSVXXXXXXXXXXXLKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTG
1ad3A           ETTELLKER--FDHIMYTGSTAVGKIVMAAAALTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSG
3ju8A           ETGVALAAHRGLDGLFFTGSSRTGNLLHSQFGGQPILALEGGNNPXXXXXXXXXXXXXYTIIQSAFISAG
2vroB           GLLDQI---RSFDVVSFTGSADTAATLRA----HPAFVQRGARNSAILCADATPDTPAKEVVREMTVKSG
2vroA           GLLDQI---RSFDVVSFTGSADTAATLRA----HPAFVQRGARNSAILCADATPDTPAKEVVREMTVKSG
1eyyB           ALGQALVSHPEIKAVGFTGSVGGGRALFNLAHERPEPIELGAINPTFIFPSAMRAKAADQFVASMTMGCG
1eyyA           ALGQALVSHPEIKAVGFTGSVGGGRALFNLAHERPEPIELGAINPTFIFPSAMRAKAADQFVASMTMGCG
1co3B           ALGQALVSHPEIKAVGFTGSVGGGRALFNLAHERPEPIELGAINPTFIFPSAMRAKAADQFVASMTMGCG
1co3A           ALGQALVSHPEIKAVGFTGSVGGGRALFNLAHERPEPIELGAINPTFIFPSAMRAKAADQFVASMTMGCG
1o20A           SL---VLEIRLREYLSLV--IPRGG-YGLISFVRPVLETGVGNCHIFVDESADLKKAVPVIINAKTQRPG


                         .         *         .         .         .         .         +:350
query           QRCTAIKRVIVLESVADKLATLLQEEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTP
1euhA           QRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADYVEGLINDANDKGATALTE
2id2C           QRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADYVEGLINDANDKGATALTE
2id2A           QRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADYVEGLINDANDKGATALTE
2esdA           QRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADYVEGLINDANDKGATALTE
1qi1A           QRSTAVKRVLVMESVADELVEKIREKVLALTIGNPEDDADITPLIDTKSADYVEGLINDANDKGATALTE
3ifgA           QTCVCTNRFFVHERVYDAFADKLAAAVSKLKVGRGTESATLGPLINEAAVKKVESHIADALAKGASLMTG
1ky8A           QRCDAIKLVLAERPVYGKLVEEVAKRLSSLRVGDPRDTVDVGPLISPSAVDEMMAAIEDAVEKXXXXXXX
1uxvA           QRCDAIKLVLAERPVYGKLVEEVAKRLSSLRVGDPRDTVDVGPLISPSAVDEMMAAIEDAVEKXXXXXXX
1uxnA           QRCDAIKLVLAERPVYGKLVEEVAKRLSSLRVGDPRDTVDVGPLISPSAVDEMMAAIEDAVEKXXXXXXX
1bxsA           QCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECP
2ve5A           QVCTNGTRVFIHRSQQARFEAKVLERVQRIRLGDPQDNTNFGPLVSFPHMESVLGYIESGKAQKARLLCG
1bi9D           QCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG
1bi9C           QCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG
1bi9B           QCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG
1bi9A           QCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG
1a4sA           QVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVGDPLTETRMGGLISKPQLDKVLGFVAQAKKEGARVLDP
1o9jA           QSCIAASKLFVEEAIYDEFVQRSVERAKKYVFGNPLPGVNHGPQINKAQHNKIMELIESGKKEGAKLECP
2ve5C           Q-VTNGTRVFIHRSQQARFEAKVLERVQRIRLGDPQDNTNFGPLVSFPHMESVLGYIESGKAQKARLLCG
2onnA           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
1o02A           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
1o01C           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
1t90A           ERCMACAVVTVEEGIADEFMAKLQEKVADIKIGNGLDDGVLGPVIREDNKKRTLSYIEKGLEEGARLVCD
2opxA           QVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNPAERNDIAPLINAAA-------LERVEQKXXXXXKA
1o04A           QCSCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
2hg2A           QVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNPAERNDIAPLINAAA-------LERVEQKXXXXXKA
2iluA           QVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNPAERNDIAPLINAAA-------LERVEQKXXXXXKA
3b4wA           QGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPPSDAAQIGPLISEKQRTRVEGYIAKGIEEGARLVCG
2onmA           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
1a4zA           QCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKVLGYIKSXXXXXXXXXXX
3fg0E           QVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDDTEMGPVISTEHRNKIESYMDVAKAEGATIAVG
3fg0D           QVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDDTEMGPVISTEHRNKIESYMDVAKAEGATIAVG
3fg0C           QVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDDTEMGPVISTEHRNKIESYMDVAKAEGATIAVG
3fg0A           QVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDDTEMGPVISTEHRNKIESYMDVAKAEGATIAVG
3ed6A           QVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDDTEMGPVISTEHRNKIESYMDVAKAEGATIAVG
2o2pA           ENCIAAGRLFVEESIHNQFVQXXXXXXXXXXIGNPLER-DTNHGPQNHEA-HLRKLVEYCQRKEGATLNQ
3ek1G           QTCVCANRIYVQRGVYDKFXXXXXXXXXXXXXGNGTEGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITG
3ek1B           QTCVCANRIYVQRGVYDKFXXXXXXXXXXXXXGNGTEGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITG
3ek1A           QTCVCANRIYVQRGVYDKFXXXXXXXXXXXXXGNGTEGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITG
2w8nA           QTCVCSNQFLVQRGIHDAFVKAFAEAMKKLRVGNGFEEGTTQPLINEKAVEKVEKQVNDAVSKGATVVTG
2w8pA           QTAVCSNQFLVQRGIHDAFVKAFAEAMKKLRVGNGFEEGTTQPLINEKAVEKVEKQVNDAVSKGATVVTG
1zumA           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
2j6lB           QRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVKV
2j6lA           QRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVKV
2bhpA           QKCSAASRLILTQGAYEPVLERVLKRAERLSVGPAEENPDLGPVVSAEQERKVLSYIE-IGKNEGQLVLG
1uzbA           QKCSAASRLILTQGAYEPVLERVLKRAERLSVGPAEENPDLGPVVSAEQERKVLSYIE-IGKNEGQLVLG
2w8oA           QTCVCSNQFLVQRGIHDAFVKAFAEAMKKLRVGNGFEEGTTQPLINEKAVEKVEKQVNDAVSKGATVVTG
3i44A           QSCNAPTRMLVEQAIYDKAIKTAKDIAEKTQVGPGHQTGNIGPVVSKEQYDKIQDLIQSGIDEGATLVTP
1zumD           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
2bjaA           QK-SAASRLILTQGAYEPVLERVLKRAERLSVGPAEENPDLGPVVSAEQERKVLSYIE-IGKNEGQLVLG
1zumE           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
1zumJ           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
1zumC           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
1zumL           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
1zumI           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
2d4eC           ERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDETEVGPLIHPEHLQRVLGYVEAGKREGARLLVG
2d4eA           ERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDETEVGPLIHPEHLQRVLGYVEAGKREGARLLVG
1zumB           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
1wnbA           QDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDESELGPLSSLAHLERVGKAVEEAKATHIKVITG
2jg7A           QRCTTTRRLMLHESVHDAVVERIAKAYKQVRIGDPWDPSTLGPLHTKQAVDQYLAAIEQAKQQGGTLVCG
1zumK           QCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSTEQGPQVDETQFKKILGYINTGKQEGAKLLCG
3etfD           QVCAAAKRFIVEEGIAQAFTDRFVXXXXXLK-GDPLEENDLGP----ARFDLRDELHQQVQASVAEGAEK
3etfC           QVCAAAKRFIVEEGIAQAFTDRFVXXXXXLK-GDPLEENDLGP----ARFDLRDELHQQVQASVAEGAEK
3etfB           QVCAAAKRFIVEEGIAQAFTDRFVXXXXXLK-GDPLEENDLGP----ARFDLRDELHQQVQASVAEGAEK
3efvC           QVCAAAKRFIVEEGIAQAFTDRFVXXXXXLK-GDPLEENDLGP----ARFDLRDELHQQVQASVAEGAEK
3efvA           QVCAAAKRFIVEEGIAQAFTDRFVXXXXXLK-GDPLEENDLGP----ARFDLRDELHQQVQASVAEGAEK
1ad3A           QTCVAPDYILCDPSIQNQIVEKLKKSLKDFYGEDAKQSRDYGRIINDRHFQRVKGLIDN--QKVAHGGT-
3ju8A           QRCTCARRLLVPQGAGDALLARLVAVSATLRVG-RFDEAPFGAVISLSAAEHLLKAQEHLIGKGAQATQP
2vroB           QKCTAIRRAFVPEAALEPVLEALKAKLAKITVGNPRNDARMGSLVSREQYENVLAGIAALREEDSSAVPL
2vroA           QKCTAIRRAFVPEAALEPVLEALKAKLAKITVGNPRNDARMGSLVSREQYENVLAGIAALREEDSSAVPL
1eyyB           QFCTKPGVVFALQAFIETAQSLIRQQSPSTLLTPGIRDSYQSQVVSRGSDDGIDVTFSQAESPVASALFV
1eyyA           QFCTKPGVVFALQAFIETAQSLIRQQSPSTLLTPGIRDSYQSQVVSRGSDDGIDVTFSQAESPVASALFV
1co3B           QFCTKPGVVFALQAFIETAQSLIRQQSPSTLLTPGIRDSYQSQVVSRGSDDGIDVTFSQAESPVASALFV
1co3A           QFCTKPGVVFALQAFIETAQSLIRQQSPSTLLTPGIRDSYQSQVVSRGSDDGIDVTFSQAESPVASALFV
1o20A           T-CNAAEKLLVHEKIAKEFLPVIVEELRKVEVRGCEKTREIVPDVVPATEDD------------------


                         .         .         .         .         *         .         .:420
query           IKREGNLLWPVLFDQVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIA
1euhA           IKREGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIA
2id2C           IKREGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIA
2id2A           IKREGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIA
2esdA           IKREGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIA
1qi1A           IKREGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIA
3ifgA           GKRHAGFFEPTVLTGVKPDMDVAKEETFGPLAPLFRFASEEELVRLANDTEFGLAAYLYSRDIGRVWRVA
1ky8A           XXXXXTYVQPTLVEAPAKDMVLYKREVFAPVASAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAV
1uxvA           XXXXXTYVQPTLVEAPAKDMVLYKREVFAPVALAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAV
1uxnA           XXXXXPTYVQPTFVEAVKDMVLYKREVFAPVALAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAV
1bxsA           WGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVS
2ve5A           GERKGAYVAPTVFTDCRDDMTIVREEIFGPVMSILVYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAI
1bi9D           GKRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVS
1bi9C           GKRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVS
1bi9B           GKRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVS
1bi9A           GKRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVS
1a4sA           KLKNGYFMSPCVLDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRAHRVA
1o9jA           WGNKGYFIQPTVFSNVTDDMRIAKEEIFGPVQQIMKFKSLDEVIKRANNTYYGLVAGVFTKDLDKAVTVS
2ve5C           GERKGAYVAPTVFTDCRDDMTIVREEIFGPVMSILVYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAI
2onnA           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLS
1o02A           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLS
1o01C           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLS
1t90A           VSDDGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIRYFR
2opxA           VEGKGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEEAISMANDSDYGLTSSIYTQNLNVAMKAI
1o04A           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLS
2hg2A           VEGKGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAI
2iluA           VEGKGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAI
3b4wA           GGRNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVWTTDVPKGIKIS
2onmA           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLS
1a4zA           XXXRGYFIQPTVFGDLQDGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLS
3fg0E           GKRDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVA
3fg0D           GKRDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVA
3fg0C           GKRDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVA
3fg0A           GKRDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVA
3ed6A           GKRDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVA
2o2pA           VPRPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFADVDAVLSRANATEFGLASGVFTRDINKALYVS
3ek1G           GKELGGLFFPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVS
3ek1B           GKELGGLFFPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVS
3ek1A           GKELGGLFFPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVS
2w8nA           GKRHKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTXXXXXXXXXXXDVGLAGYFYSQDPAQIWRVA
2w8pA           GKRHKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTXXXXXXXXXXXDVGLAGYFYSQDPAQIWRVA
1zumA           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLS
2j6lB           MDRPGNYVEPTIVTGLGHDASIAHTETFAPILYVFKFQNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWP
2j6lA           MDRPGNYVEPTIVTGLGHDASIAHTETFAPILYVFKFQNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWP
2bhpA           GKREGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWAR
1uzbA           GKREGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWAR
2w8oA           GKRHKNFFEPTLLCNVTQDMLT-----FGPLAPVIKFDTXXXXXXXXXXXDVGLAGYFYSQDPAQIWRVA
3i44A           MGMEGYYVRPTVFADVKPHMRIFREEIFGPVLSLLPFNTEDEAVTLANDTEYGLTNYIQSQDRSKCRRIA
1zumD           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLS
2bjaA           GKREGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWAR
1zumE           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLS
1zumJ           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLS
1zumC           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLS
1zumL           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLS
1zumI           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLS
2d4eC           GERRGNYLLPTVF-VGENHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTXXXXXXXXXX
2d4eA           GERRGNYLLPTVF-VGENHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTXXXXXXXXXX
1zumB           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLS
1wnbA           EKRKGNGYYPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHRVS
2jg7A           GKRPGNYVEPTIITGLAHDAPIVHTETFVPILYVLKFKTEEEAFAWNNEVQQGLSSSIFTKDLGRVFRWP
1zumK           AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNS--GLAAAVFTKDLDKANYLS
3etfD           IAGEGNYYAATVLADVTPDTAFR-QELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-A
3etfC           IAGEGNYYAATVLADVTPDTAFR-QELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-A
3etfB           IAGEGNYYAATVLADVTPDTAFR-QELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-A
3efvC           IAGEGNYYAATVLADVTPDTAFR-QELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-A
3efvA           IAGEGNYYAATVLADVTPDTAFR-QELFGPVAAITVXXXXXXXXXXXNDSEFGLSATIFTADDTLAAE-A
1ad3A           WDQSSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKVIKKMI
3ju8A           IDGAA-LLTPGILD-VSAVAERPDEEFFGPLLQVIRYSDFAAAIREANATQYGLAAGLLSDSRERFEQFL
2vroB           IDADANIVAPHLFVVNDPDNATLLHEVFGPVASVYRVTALPEAVALARRGQGSLVASIYSND--------
2vroA           IDADANIVAPHLFVVNDPDNATLLHEVFGPVASVYRVTTEAHAVALARRGQGSLVASIYSND--------
1eyyB           TSSENWRKHP------------AWEEEFGPQSLIVVCENVADMLSLSEMLAGSLTATIHAEDYPQVSQLI
1eyyA           TSSENWRKHP------------AWEEEFGPQSLIVVCENVADMLSLSEMLAGSLTATIHAEDYPQVSQLI
1co3B           TSSENWRKHP------------AWEEEFGPQSLIVVCENVADMLSLSEMLAGSLTATIHAEDYPQVSQLI
1co3A           TSSENWRKHP------------AWEEEFGPQSLIVVCENVADMLSLSEMLAGSLTATIHAEDYPQVSQLI
1o20A           --------WPTEYLDLIIAIKV--------------VKNVDEAIEHIKKYSTGHSESILTENYSNAKKFV


                         .         .         +         .         .         .         .:490
query           EKLEVGTVHINNKTQRGPDNFPFLGVKGSGAGVQGIKYSIEAMTNVKSIVFDVK
1euhA           EQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDIK
2id2C           EQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDIK
2id2A           EQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDIK
2esdA           EQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDIK
1qi1A           EQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDIK
3ifgA           EALEYGMVGINTGLISN-EVAPFGGVKQSGLGREGSHYGIDDYVVIK-------
1ky8A           RLLEVGAIYINDMPRHGIGYYPFGGRKKSGVFREGIGYAVEAVTAYKTIVFNYK
1uxvA           RLLEVGAIYINDMPRHGIGYYPFGGRKKSGVFREGIGYAVEAVTAYKTIVFNYK
1uxnA           RLLEVGAIYINDMPRHGIGYYPFGGRKKSGVFREGIGYAVEAVTAYKTIVFNYK
1bxsA           SALQSGTVWVNCYSVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIKI-
2ve5A           HRLEAGICWINTWGE-SPAEMPVGGYKQSGVGRENGLTTLAHYTRIKSV-----
1bi9D           SAMQAGTVWIN-------------------------------------------
1bi9C           SAMQAGTVWIN-------------------------------------------
1bi9B           SAMQAGTVWIN-------------------------------------------
1bi9A           SAMQAGTVWIN-------------------------------------------
1a4sA           ANLEAGTCYINTYS-ISPVEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVEM-
1o9jA           SALQAGTVWVNCYLAASAQS-PAGGFKMSGHGREMGEYGIHEYTEVKTVTMKI-
2ve5C           HRLEAGICWINTWGE-SPAEMPVGGYKQSGVGRENGLTTLAHYTRIKSV-----
2onnA           QALQAGTVWVNCYDVFGAQS-PFGGYKMSGSGQELGEYGLQAYTEVKTVTVKV-
1o02A           QALQAGTVWVNCYDVFGAQS-PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKV-
1o01C           QALQAGTVWVNCYDVFGAQS-PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKV-
1t90A           ENIDAGMLGINLGVPAPMAFFPFSGWKSSFFG----------------------
2opxA           KGLKFGETYINRENFEAMQGF-HAGWRKSGIG----------------------
1o04A           QALQAGTVWVNCYDVFGAQS-PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKV-
2hg2A           KGLKFGETYINRENFEAMQGF-HAGWRKSGIG----------------------
2iluA           KGLKFGETYINRENFEAMQGF-HAGWRKSGIG----------------------
3b4wA           QQIRTGTYGIN--WYAFDPGSPFGGYKNSGIGRENGPEGVEHFTQQKSVL----
2onmA           QALQAGTVWVNCYDVFGAQS-PFGGYKMSGSGRELGEYGLQA------------
1a4zA           QALQAGTVWVNCYDVFGAQS-PFGGYKLSGSGRELGEYGLQAYTEVKTVTVRV-
3fg0E           NKLKLGTVWINDFHPYFA-QAPWGGYKQSGIGRELGKEGLEEYLVSKHIL----
3fg0D           NKLKLGTVWINDFHPYFA-QAPWGGYKQSGIGRELGKEGLEEYLVSKHIL----
3fg0C           NKLKLGTVWINDFHPYFA-QAPWGGYKQSGIGRELGKEGLEEYLVSKHIL----
3fg0A           NKLKLGTVWINDFHPYFA-QAPWGGYKQSGIGRELGKEGLEEYLVSKHIL----
3ed6A           NKLKLGTVWINDFHPYFA-QAPWGGYKQSGIGRELGKEGLEEYLVSKHIL----
2o2pA           DKLQAGTVFINNKTDVAA---PFGGFKQSGFGKDLGEAALNEYLRIKTVTFE--
3ek1G           EALEYGMVG-HNTGLISNEVAPFGGVKQSGLGREGSKYGIEEYLETKYI-----
3ek1B           EALEYGMVG-HNTGLISNEVAPFGGVKQSGLGREGSKYGIEEYLETKYI-----
3ek1A           EALEYGMVG-HNTGLISNEVAPFGGVKQSGLGREGSKYGIEEYLETKYI-----
2w8nA           EQLEVGMVGVNEGLISSVE-CPFGGVKQSGLGREGSKYGIDEYLELKYVCY---
2w8pA           EQLEVGMVGVNEGLISSVE-CPFGGVKQSGLGREGSKYGIDEYLELKYVCY---
1zumA           QALQAGTVWVN-------------------------------------------
2j6lB           KGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGG----------------------
2j6lA           KGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGG----------------------
2bhpA           REFHVGNLYFNRKTGALVGVQPFGGFKLSGTNAK--------------------
1uzbA           REFHVGNLYFNRKTGALVGVQPFGGFKLSGTNAK--------------------
2w8oA           EQLEVGMVGVNEGLISSVE-CPFGGVKQSGLGREGSKYGIDEYLELKYVCY---
3i44A           AQVRSGMVEVNGHELPGGSYFG--GVKFSGRAREGGLWGIKEFLDTKAISY---
1zumD           QALQAGTVWVNCYDVFGAQS-PFGGYLG--------------------------
2bjaA           REFHVGNLYFNRKTGALVGVQPFGGFKLSGTNAK--------------------
1zumE           QALQAGTVWVNCYDVFGAQS-PFGGYRELG------------------------
1zumJ           QALQAGTVWVNCYDVFGAQS-PFGGYELGEYGLQ--------------------
1zumC           QALQAGTVWVN-------------------------------------------
1zumL           QALQAGTVWVNCYDVFGAQS-PFLGEYG--------------------------
1zumI           QALQAGTVWVNCYDVFGAQS-PFGGYRELG------------------------
2d4eC           XXXXXGMVYLNSHNVRHLPT-PFGGVKGSGDRREGGTYALDFYTDLKTIALPLR
2d4eA           XXXXXGMVYLNSHNVRHLPT-PFGGVKGSGDRREGGTYALDFYTDLKTIALPLR
1zumB           QALQAGTVWVN-------------------------------------------
1wnbA           ARLQYGCTWVNTHFML-VSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVM----
2jg7A           KGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGG----------------------
1zumK           QALQAGTVWVN-------------------------------------------
3etfD           ARLECGGVFINGYS-ASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTV-----
3etfC           ARLECGGVFINGYS-ASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTV-----
3etfB           ARLECGGVFINGYS-ASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTV-----
3efvC           ARLECGGVFINGYS-ASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTV-----
3efvA           ARLECGGVFINGYS-ASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTV-----
1ad3A           AETSSGGVTANDVVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRS------
3ju8A           VESRAGIVNWNKQLTGAASSAPFGGIGASG------------------------
2vroB           ------------------------------------------------------
2vroA           ------------------------------------------------------
1eyyB           PRLE--------------------------------------------------
1eyyA           PRLE--------------------------------------------------
1co3B           PRLE--------------------------------------------------
1co3A           PRLE--------------------------------------------------
1o20A           SEIDAAAVYVNASTR---------------------------------------