[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55996.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eyqB.bssp"
#ERROR : Can't open dsspfile "2eyqA.bssp"
#ERROR : Can't open dsspfile "1gm5A.bssp"
#ERROR : Can't open dsspfile "1d2mA.bssp"
#ERROR : Can't open dsspfile "1c4oA.bssp"
#ERROR : Can't open dsspfile "1t5lA.bssp"
#ERROR : Can't open dsspfile "1d9zA.bssp"
#ERROR : Can't open dsspfile "1d9xA.bssp"
#ERROR : Can't open dsspfile "2d7hA.bssp"
#ERROR : Can't open dsspfile "2fdcB.bssp"
#ERROR : Can't open dsspfile "2nmvA.bssp"
#ERROR : Can't open dsspfile "2d7dA.bssp"
#ERROR : Can't open dsspfile "2fdcA.bssp"
#ERROR : Can't open dsspfile "2d7hD.bssp"
#ERROR : Can't open dsspfile "2d7gA.bssp"
#ERROR : Can't open dsspfile "2d7eD.bssp"
#ERROR : Can't open dsspfile "2d7eB.bssp"
#ERROR : Can't open dsspfile "2d7eA.bssp"
#ERROR : Can't open dsspfile "2j0sA.bssp"
#ERROR : Can't open dsspfile "2j0qA.bssp"
#ERROR : Can't open dsspfile "2hyiC.bssp"
#ERROR : Can't open dsspfile "2hxyA.bssp"
#ERROR : Can't open dsspfile "2kbfA.bssp"
#ERROR : Can't open dsspfile "3gfpA.bssp"
#ERROR : Can't open dsspfile "2z0mA.bssp"
#ERROR : Can't open dsspfile "1wp9A.bssp"
#ERROR : Can't open dsspfile "2d7gD.bssp"
#ERROR : Can't open dsspfile "3eaqA.bssp"
#ERROR : Can't open dsspfile "3easA.bssp"
#ERROR : Can't open dsspfile "3earA.bssp"
#ERROR : Can't open dsspfile "3eaqB.bssp"
#ERROR : Can't open dsspfile "1wp9D.bssp"
#ERROR : Can't open dsspfile "1wp9C.bssp"
#ERROR : Can't open dsspfile "1wp9B.bssp"
#ERROR : Can't open dsspfile "2hjvB.bssp"
#ERROR : Can't open dsspfile "2hjvA.bssp"

## Summary of PDB Search
:798
    2e-11  34%  2eyqB  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    2e-11  34%  2eyqA  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    9e-10  33%  1gm5A  [a.24.21 - b.40.4 - c.37.1 - c.37.1] RECG
    6e-07  42%  1d2mA  [c.37.1 - c.37.1] EXCINUCLEASE ABC SUBUNIT B
    6e-07  42%  1c4oA  [c.37.1 - c.37.1] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB
    2e-06  34%  1t5lA  [c.37.1 - c.37.1] UVRABC SYSTEM PROTEIN B
    2e-06  34%  1d9zA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    2e-06  34%  1d9xA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    2e-06  49%  2d7hA  [x.x.x] PRIMOSOMAL PROTEIN N
    6e-06  42%  2fdcB  [x.x.x] UVRABC SYSTEM PROTEIN B
    8e-06  33%  2nmvA  [x.x.x] UVRABC SYSTEM PROTEIN B
    8e-06  33%  2d7dA  [x.x.x] UVRABC SYSTEM PROTEIN B
    1e-05  48%  2fdcA  [x.x.x] UVRABC SYSTEM PROTEIN B
    2e-05  50%  2d7hD  [x.x.x] PRIMOSOMAL PROTEIN N
    2e-05  51%  2d7gA  [x.x.x] PRIMOSOMAL PROTEIN N
    2e-05  51%  2d7eD  [x.x.x] PRIMOSOMAL PROTEIN N'
    2e-05  51%  2d7eB  [x.x.x] PRIMOSOMAL PROTEIN N'
    2e-05  51%  2d7eA  [x.x.x] PRIMOSOMAL PROTEIN N'
    7e-05  32%  2j0sA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX48
    7e-05  32%  2j0qA  [x.x.x] ATP-DEPENDENT RNA HELICASE DDX48
    7e-05  32%  2hyiC  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX48
    7e-05  32%  2hxyA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX48
    1e-04  31%  2kbfA  [x.x.x] ATP-DEPENDENT RNA HELICASE DBP5
    2e-04  29%  3gfpA  [x.x.x] DEAD BOX PROTEIN 5
    3e-04  33%  2z0mA  [x.x.x] 337AA LONG HYPOTHETICAL ATP-DEPENDENT RNA
    3e-04  40%  1wp9A  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    4e-04  52%  2d7gD  [x.x.x] PRIMOSOMAL PROTEIN N
    6e-04  35%  3eaqA  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    8e-04  35%  3easA  [x.x.x] HERA
    8e-04  35%  3earA  [x.x.x] HERA
    8e-04  35%  3eaqB  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    0.001  48%  1wp9D  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    0.001  48%  1wp9C  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    0.001  48%  1wp9B  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    0.001  32%  2hjvB  [x.x.x] ATP-DEPENDENT RNA HELICASE DBPA
    0.001  32%  2hjvA  [x.x.x] ATP-DEPENDENT RNA HELICASE DBPA
:798

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxAKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSDGEEMEQDLKD
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2d7hA           ---AHVALPVPLPRT---FDYLLPE---GMVKAGCRVRVPFGKQQERI-GIVV---SVSDASELPNELKA
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2d7hD           ------------------FDYLLPE---GMVKAGCRVRVPFGQQERI--GIVV---SVSDASELPNELKA
2d7gA           ------------------FDYLLPE---GMVKAGCRVRVPFGKQQERI-GIVV---SVSDASELPNELKA
2d7eD           ------------------FDYLLPE---GMVKAGCRVRVPFGKQQERI-GIVV---SVSDASELPNELKA
2d7eB           ------------------FDYLLPE---GMVKAGCRVRVPFGKQQERI-GIVV---SVSDASELPNELKA
2d7eA           ------------------FDYLLPE---GMVKAGCRVRVPFGKQQERI-GIVV---SVSDASELPNELKA
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2d7gD           ------------------FDYLLPE---GMVKAGCRVRVPFGKQQERI-GIVV---SVSDASELPNELKA
3eaqA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IAEVLDFSPVLTPEQLWLAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2d7hA           VVEVLDSEPVFTHSLLWAAD--------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2d7hD           VVEVLDSEPVFTHSLLWAAD--------------------------------------------------
2d7gA           VVEVLDSEPVFTHSLLWAAD--------------------------------------------------
2d7eD           VVEVLDSEPVFTHSLLWAAD--------------------------------------------------
2d7eB           VVEVLDSEPVFTHSLLWAAD--------------------------------------------------
2d7eA           VVEVLDSEPVFTHSLLWAAD--------------------------------------------------
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2d7gD           VVEVLD--PVFTHSLLWAAD--------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxFVDQGAVTIVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSS
2eyqB           ----------------------------------------------SFPFETTPDQAQAINAVLSDM--C
2eyqA           ----------------------------------------------SFPFETTPDQAQAINAVLSDM--C
1gm5A           --------------------FVLQLAFQKIRKEREKHGGIPKKIEGSLPFKLTNAQKRAHQEIRNDMISE
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKY
2eyqB           QPDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANRIEMISRFRSAKEQT
2eyqA           QPDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANRIEMISRFRSAKEQT
1gm5A           KPMNLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTVSKFNIHVALLIGATTPSEKE
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGS
2eyqB           QILAEVAEGKIDILIGTHKLLQSDVKDLGLLIVDEEHRFGVR-------HKERIKAMRANVDILTL---T
2eyqA           QILAEVAEGKIDILIGTHKLLQSDVKDLGLLIVDEEHRFGVR-------HKERIKAMRANVDILTL---T
1gm5A           KIKSGLRNGQIDVVIGTHALIQEDVKNLGLVIIDEQH---------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ATPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqB           ATP-------------------------------------------------------------------
2eyqA           ATP-------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTGTQ
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
1t5lA           ------------------------------------------------------------------TLTK
1d9zA           ------------------------------------------------------------------TLTK
1d9xA           ------------------------------------------------------------------TLTK
2d7hA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ------------------------------------------------------------------TLTK
2d7dA           ------------------------------------------------------------------TLTK
2fdcA           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2j0sA           --------------------------------------------------------------------TK
2j0qA           --------------------------------------------------------------------TK
2hyiC           --------------------------------------------------------------------TK
2hxyA           --------------------------------------------------------------------TK
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2z0mA           --------------------------------------------------------------------TR
1wp9A           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
3eaqA           --------------------------------------------------------------------TE
3easA           --------------------------------------------------------------------TE
3earA           --------------------------------------------------------------------TE
3eaqB           --------------------------------------------------------------------TE
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTA
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1d2mA           -----------RARYLHHELDAFKR----QALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADK-
1c4oA           -----------RARYLHHELDAFKR----QALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADK-
1t5lA           KMAEDLTDYLKEAGIKVAYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADK-
1d9zA           KMAEDLTDYLKEAGIKVAYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADK-
1d9xA           KMAEDLTDYLKEAGIKVAYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADK-
2d7hA           ----------------------------------------------------------------------
2fdcB           ----------------------------HIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADK-
2nmvA           KMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADK-
2d7dA           KMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADK-
2fdcA           --------------------------------------GKYDVLVGINLLREGLDIPEVSLVAILDADK-
2d7hD           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2j0sA           RKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSL--IINYD--
2j0qA           RKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSL--IINYD--
2hyiC           RKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSL--IINYD--
2hxyA           RKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSL--IINYD--
2kbfA           --YGKLKSEGHEVSILHGDLQTQER----DRLIDDFREGRSKVLITTNVLARGIDIPTVSM--VVNYD--
3gfpA           --YGKLKSEGHEVSILHGDLQTQER----DRLIDDFREGRSKVLITTNVLARGIDIPTVSVVN-------
2z0mA           NRVAKLVRLFDNAIELRGDLPQSVRNRN----IDAFREGEYDMLITTDVASRGLDIPLVE--KVINFDAP
1wp9A           -------------------VGQASKQREQKLILDEFARGEFNVLVATSVGEEGLDVPEVDLV--------
2d7gD           ----------------------------------------------------------------------
3eaqA           EIAQGLLRLGHPAQALHGDLS----QGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLV------VH
3easA           EIAQGLLRLGHPAQALHGDLS----QGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLV--------
3earA           EIAQGLLRLGHPAQALHGDLS----QGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLV--------
3eaqB           EIAQGLLRLGHPAQALHGDLS----QGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLV--------
1wp9D           -------------------------------ILDEFARGEFNVLVATSVGEEGLDVPEVDLV--------
1wp9C           -------------------------------ILDEFARGEFNVLVATSVGEEGLDVPEVDLV--------
1wp9B           -------------------------------ILDEFARGEFNVLVATSVGEEGLDVPEVDLV--------
2hjvB           -------------------------------VMNEFKRGEYRYLVATDVAARGIDIENISL--VINYDLP
2hjvA           -------------------------------VMNEFKRGEYRYLVATDVAARGIDIENISL--VINYDLP


                         .         +         .         .         .         .         *:700
query           LNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFxxxxxxxxxxxxxxx
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1d2mA           ---EGFLRSERS---LIQTIGRAAR---------------------------------------------
1c4oA           ---EGFLRSERS---LIQTIGRAAR---------------------------------------------
1t5lA           ---EGFLRSERS---LIQTIGRAAR---------------------------------------------
1d9zA           ---EGFLRSERS---LIQTIGRAAR---------------------------------------------
1d9xA           ---EGFLRSERS---LIQTIGRAAR---------------------------------------------
2d7hA           ----------------------------------------------------------------------
2fdcB           ---EGFLRSERS---LIQTIGRAAR---------------------------------------------
2nmvA           ---EGFLRSERS---LIQTIGRAAR---------------------------------------------
2d7dA           ---EGFLRSERS---LIQTIGRAAR---------------------------------------------
2fdcA           ---EGFLRSERS---LIQTIGRAAR---------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2j0sA           --LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVKNDD-------------------
2j0qA           --LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVKNDD-------------------
2hyiC           --LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVKNDD-------------------
2hxyA           --LPNNR------ELYIHRIGRSGR-----------YGRKGVAINFVKNDD-------------------
2kbfA           --LPTLANGQADPATYIHRIGRTGRFGRKG----------------------------------------
3gfpA           YDLPTLANGQADPATYIHRIGRTGRFGRKG----------------------------------------
2z0mA           QDL-------RTYIHRIGRTGRMGRKGEAITFILNEY---------------------------------
1wp9A           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
3eaqA           YRLPD---RAEAYQHRSGRTGRAG----------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           LEKESY----------VHRTGRTGRAGNKGKAI--SFVTAFEKRFLADIEEYIGF---------------
2hjvA           LEKESY----------VHRTGRTGRAGNKGKAI--SFVTAFEKRFLADIEEYIGF---------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2d7hA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
2fdcA           ----------------------------------------------------------------------
2d7hD           ----------------------------------------------------------------------
2d7gA           ----------------------------------------------------------------------
2d7eD           ----------------------------------------------------------------------
2d7eB           ----------------------------------------------------------------------
2d7eA           ----------------------------------------------------------------------
2j0sA           ----------------------------------------------------------------------
2j0qA           ----------------------------------------------------------------------
2hyiC           ----------------------------------------------------------------------
2hxyA           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2d7gD           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2hjvB           ----------------------------------------------------------------------
2hjvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqB           ----------------------------
2eyqA           ----------------------------
1gm5A           ----------------------------
1d2mA           ----------------------------
1c4oA           ----------------------------
1t5lA           ----------------------------
1d9zA           ----------------------------
1d9xA           ----------------------------
2d7hA           ----------------------------
2fdcB           ----------------------------
2nmvA           ----------------------------
2d7dA           ----------------------------
2fdcA           ----------------------------
2d7hD           ----------------------------
2d7gA           ----------------------------
2d7eD           ----------------------------
2d7eB           ----------------------------
2d7eA           ----------------------------
2j0sA           ----------------------------
2j0qA           ----------------------------
2hyiC           ----------------------------
2hxyA           ----------------------------
2kbfA           ----------------------------
3gfpA           ----------------------------
2z0mA           ----------------------------
1wp9A           ----------------------------
2d7gD           ----------------------------
3eaqA           ----------------------------
3easA           ----------------------------
3earA           ----------------------------
3eaqB           ----------------------------
1wp9D           ----------------------------
1wp9C           ----------------------------
1wp9B           ----------------------------
2hjvB           ----------------------------
2hjvA           ----------------------------