[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF55997.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b5aC.bssp"
#ERROR : Can't open dsspfile "2b5aB.bssp"
#ERROR : Can't open dsspfile "2b5aA.bssp"
#ERROR : Can't open dsspfile "1y7yB.bssp"
#ERROR : Can't open dsspfile "1y7yA.bssp"
#ERROR : Can't open dsspfile "3eusB.bssp"
#ERROR : Can't open dsspfile "3eusA.bssp"

## Summary of PDB Search
:53
    5e-05  32%  2b5aC  [x.x.x] C.BCLI
    5e-05  32%  2b5aB  [x.x.x] C.BCLI
    5e-05  32%  2b5aA  [x.x.x] C.BCLI
    7e-05  35%  1y7yB  [x.x.x] C.AHDI
    7e-05  35%  1y7yA  [x.x.x] C.AHDI
    4e-04  39%  3eusB  [x.x.x] DNA-BINDING PROTEIN
    4e-04  39%  3eusA  [x.x.x] DNA-BINDING PROTEIN
:53

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxMINVCDVGKRIKELRISSNLTQDKIAEYLSLNQSMIAKMEKGERNITxxxx
2b5aC           --MINEIEIGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNIS----
2b5aB           --MINEIEIGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNIS----
2b5aA           --MINEIEIGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNIS----
1y7yB           ---------GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVS----
1y7yA           ---------GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVS----
3eusB           ----------QRLRQARLDAGLTQADLAERLDKPQSFVAKVETRERRL-----
3eusA           ----------QRLRQARLDAGLTQADLAERLDKPQSFVAKVETRERRL-----