[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56022.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2rbgA.bssp"
#ERROR : Can't open dsspfile "2dfsA.bssp"
#ERROR : Can't open dsspfile "1v9dD.bssp"
#ERROR : Can't open dsspfile "1v9dB.bssp"
#ERROR : Can't open dsspfile "1v9dA.bssp"

## Summary of PDB Search
:424
    7e-04  30%  2rbgA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN ST0493
    7e-04  30%  2dfsA  [x.x.x] MYOSIN-5A
    9e-04  29%  1v9dD  [a.207.1] DIAPHANOUS PROTEIN HOMOLOG 1
    9e-04  29%  1v9dB  [a.207.1] DIAPHANOUS PROTEIN HOMOLOG 1
    9e-04  29%  1v9dA  [a.207.1] DIAPHANOUS PROTEIN HOMOLOG 1
:424

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxTTEFDKELHDRMRQELALAEQKAMNEQQTKLAQKDQEIAQLQ
2rbgA           ----------------------------------------------------------------------
2dfsA           ----------------------------STETEKLRSDVER--LRMSEEEAKNATNRVLSLQE-EIAKLR
1v9dD           ----------------------------------------------------------------------
1v9dB           ----------------------------------------------------------------------
1v9dA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SQIQNFDTEKELAKKEVEQTSHQALLAKDKEVQALENQLATLRLEHENQLQKTLSDLEKExxxxxxxxxx
2rbgA           ----------------------------------------------------------------------
2dfsA           KELHQTQTEKKTIEEWADKYKHET----EQLVSELKEQNTLLKTEKE-ELNRRIHDQAKE----------
1v9dD           ----------------------------------------------------------------------
1v9dB           ----------------------------------------------------------------------
1v9dA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2rbgA           ----------------------------------------------------------------------
2dfsA           ----------------------------------------------------------------------
1v9dD           ----------------------------------------------------------------------
1v9dB           ----------------------------------------------------------------------
1v9dA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYAVLVTMLE
2rbgA           -------------------------------------------------------------YKNILTLIS
2dfsA           ----------------------------------------------------------------------
1v9dD           ----------------------------------------------------------------------
1v9dB           ----------------------------------------------------------------------
1v9dA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ADNDYFNTGIVDVSHEYEKMYVVRPQFFIQLIGLLRNAALNSLKYKQELALVREQNIDITHFEEDLDAFK
2rbgA           VNNDYFRKIFLDVRSSGSKKTTINVFTEIQLVTLIREALLENIDIGYELFLWKKNEVDI--FLKNLEKSE
2dfsA           ----------------------------------------------------------------------
1v9dD           ------------------------------LAELCENDHPEVLKFPDELAHVEKASVSAENLQKSLDQMK
1v9dB           ------------------------------LAELCENDHPEVLKFPDELAHVEKASVSAENLQKSLDQMK
1v9dA           ------------------------------LAELCENDHPEVLKFPDELAHVEKASVSAENLQKSLDQMK


                         .         .         .         .         *         .         .:420
query           LAFAKNYNSASTNFGKAIDEIDKAIKRMEEVKKFLTTSENQLRLANNKLExxxxxxxxxxxxxxxxxxxx
2rbgA           VDGLLVYDDENKVFSKIVDNLPTAIKR-------------------------------------------
2dfsA           ----------------------------------------------------------------------
1v9dD           KQIADVERDVQ-NFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNME--------------------
1v9dB           KQIADVERDVQ-NFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNME--------------------
1v9dA           KQIADVERDVQ-NFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNME--------------------


                         .         .         +         .         .         .         .:490
query           xxxx
2rbgA           ----
2dfsA           ----
1v9dD           ----
1v9dB           ----
1v9dA           ----