[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:atpC

[Show Plain Result]

#ERROR : Can't open dsspfile "1yceA.bssp"
#ERROR : Can't open dsspfile "1wu0A.bssp"

## Summary of PDB Search
:66
    2e-05  39%  1yceA  [x.x.x] SUBUNIT C
    1e-04  41%  1wu0A  [x.x.x] ATP SYNTHASE C CHAIN
:66

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIx
1yceA           ---------IAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALIL-
1wu0A           ---------------------------EGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFI--