[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56087.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t9hA.bssp"
#ERROR : Can't open dsspfile "1u0lA.bssp"
#ERROR : Can't open dsspfile "2yv5A.bssp"
#ERROR : Can't open dsspfile "2rcnA.bssp"

## Summary of PDB Search
:292
    2e-69  52%  1t9hA  [b.40.4 - c.37.1] PROBABLE GTPASE ENGC
    2e-41  38%  1u0lA  [b.40.4 - c.37.1] PROBABLE GTPASE ENGC
    1e-35  35%  2yv5A  [x.x.x] YJEQ PROTEIN
    3e-34  38%  2rcnA  [x.x.x] PROBABLE GTPASE ENGC
:292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPI
1t9hA           -EGKIIKALSGFYYVEDSDKVIQCRGRGIFRKNKITPLVGDYVVYQAENDKEGYLMEIKERTNELIRPPI
1u0lA           ---------------EETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHV
2yv5A           -------------YLFEDGKTYRGIPRGKVLKKTKI-YAGDYVWGEVVDPNTFAIEEVEERKNLLIRPKV
2rcnA           -EGIVISRFGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWRPGK-VKGIVEAVHERTSVLTRPPI


                         .         .         *         .         .         .         .:140
query           VNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYRQTYGDIGYDFVTSK
1t9hA           CNVDQAVLVFSAVQPSFSTALLDRFLVLVEANDIQPIICITKMDLIEDQDTEDAYAEDYRNIGYDYLTSS
1u0lA           ANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDERELEEIYSGLYPIVKTSAKTGM
2yv5A           ANVDRVIIVETLKMPEFNNYLLDNMLVVYEYFKVEPVIVFNKIDXXXXXXXXXXXRSIYRDAGYDVVSAK
2rcnA           ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH


                         +         .         .         .         .         *         .:210
query           EELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGF
1t9hA           KDQDSLFQDKTTVFAGQSGVGKSSLLNAISP-------------------TRHVELIHTSGGLVADTPGF
1u0lA           EELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRT------------TTTAQLLKFDFGGYVVDTPGF
2yv5A           DELVDYLEGFICILAGPSGVGKSSILSRLTGE-ELRTQEVTTT------GVRLIPFG--KGSFVGDTPGF
2rcnA           TQLEEALTGRISIFAGQSGVGKSSLLNAL---LGLQNEILTNTAARLYHFP--------HGGDVIDSPGV


                         .         .         .         +         .         .         .:280
query           SSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRR
1t9hA           SSLEFTDIEEEELGYTFPDIREKSSSCKFRGCLHLKEPKCAVKQAVEDGELKQYRYDHYVEFMTEIKDRK
1u0lA           ANLEINDIEPEELKHYFKEFG--DKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRR
2yv5A           SKVEATMVKPREVRNYFREF--LRYQCKYPDCTHTNEPGCAVKEAVKNGEISCERYKSYLKII-------
2rcnA           REFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESM----


                         .         *         .         .         .         .         +:350
query           ETYxxxxxxxxx
1t9hA           PRY---------
1u0lA           ------------
2yv5A           ------------
2rcnA           ------------