[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56127.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1zw2A.bssp"
#ERROR : Can't open dsspfile "1zvzA.bssp"
#ERROR : Can't open dsspfile "1xwjA.bssp"
#ERROR : Can't open dsspfile "1u6hA.bssp"
#ERROR : Can't open dsspfile "1t01A.bssp"
#ERROR : Can't open dsspfile "1st6A.bssp"
#ERROR : Can't open dsspfile "2gdcA.bssp"
#ERROR : Can't open dsspfile "1ydiA.bssp"
#ERROR : Can't open dsspfile "1syqA.bssp"
#ERROR : Can't open dsspfile "1rkeA.bssp"
#ERROR : Can't open dsspfile "1rkcA.bssp"
#ERROR : Can't open dsspfile "2hsqA.bssp"

## Summary of PDB Search
:555
    1e-04  23%  1zw2A  [x.x.x] VINCULIN
    1e-04  23%  1zvzA  [x.x.x] VINCULIN
    1e-04  23%  1xwjA  [x.x.x] VINCULIN
    1e-04  23%  1u6hA  [x.x.x] VINCULIN
    1e-04  23%  1t01A  [a.24.9 - a.24.9] UNNAMED PROTEIN PRODUCT
    1e-04  23%  1st6A  [a.24.9 - a.24.9 - a.24.9 - a.24.9 - a.24.9 - a.24.9 - a.24.9
    1e-04  26%  2gdcA  [x.x.x] VINCULIN
    4e-04  25%  1ydiA  [x.x.x] VINCULIN ISOFORM VCL
    4e-04  25%  1syqA  [a.24.9 - a.24.9] VINCULIN ISOFORM VCL
    4e-04  25%  1rkeA  [a.24.9 - a.24.9] VINCULIN
    4e-04  25%  1rkcA  [a.24.9 - a.24.9] VINCULIN
    4e-04  25%  2hsqA  [x.x.x] VINCULIN
:555

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1zw2A           ----------------------------------------------------------------------
1zvzA           ----------------------------------------------------------------------
1xwjA           ----------------------------------------------------------------------
1u6hA           ----------------------------------------------------------------------
1t01A           ----------------------------------------------------------------------
1st6A           ----------------------------------------------------------------------
2gdcA           ----------------------------------------------------------------------
1ydiA           ----------------------------------------------------------------------
1syqA           ----------------------------------------------------------------------
1rkeA           ----------------------------------------------------------------------
1rkcA           ----------------------------------------------------------------------
2hsqA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1zw2A           ----------------------------------------------------------------------
1zvzA           ----------------------------------------------------------------------
1xwjA           ----------------------------------------------------------------------
1u6hA           ----------------------------------------------------------------------
1t01A           ----------------------------------------------------------------------
1st6A           ----------------------------------------------------------------------
2gdcA           ----------------------------------------------------------------------
1ydiA           ----------------------------------------------------------------------
1syqA           ----------------------------------------------------------------------
1rkeA           ----------------------------------------------------------------------
1rkcA           ----------------------------------------------------------------------
2hsqA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1zw2A           ----------------------------------------------------------------------
1zvzA           ----------------------------------------------------------------------
1xwjA           ----------------------------------------------------------------------
1u6hA           ----------------------------------------------------------------------
1t01A           ----------------------------------------------------------------------
1st6A           ----------------------------------------------------------------------
2gdcA           ----------------------------------------------------------------------
1ydiA           ----------------------------------------------------------------------
1syqA           ----------------------------------------------------------------------
1rkeA           ----------------------------------------------------------------------
1rkcA           ----------------------------------------------------------------------
2hsqA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1zw2A           ----------------------------------------------------------------------
1zvzA           ----------------------------------------------------------------------
1xwjA           ----------------------------------------------------------------------
1u6hA           ----------------------------------------------------------------------
1t01A           ----------------------------------------------------------------------
1st6A           ----------------------------------------------------------------------
2gdcA           ----------------------------------------------------------------------
1ydiA           ----------------------------------------------------------------------
1syqA           ----------------------------------------------------------------------
1rkeA           ----------------------------------------------------------------------
1rkcA           ----------------------------------------------------------------------
2hsqA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEYALIAVVAGKG
1zw2A           ----LVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKL
1zvzA           ----LVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKL
1xwjA           ----LVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKL
1u6hA           ----LVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKL
1t01A           ----LVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKL
1st6A           ----LVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKL
2gdcA           ------------------------------------------KVENACTKLVRAAQMLQ-----------
1ydiA           ------------------------------------------KVENACTKLVQAAQMLQ-----------
1syqA           ------------------------------------------KVENACTKLVQAAQMLQ-----------
1rkeA           ------------------------------------------KVENACTKLVQAAQMLQ-----------
1rkcA           ------------------------------------------KVENACTKLVQAAQMLQ-----------
2hsqA           ------------------------------------------KVENACTKLVQAAQMLQ-----------


                         .         .         .         .         *         .         .:420
query           LADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNXFMAAQSAAEVLEQPAVVVEART
1zw2A           VADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
1zvzA           VADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
1xwjA           VADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
1u6hA           VADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
1t01A           VADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
1st6A           VADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
2gdcA           -ADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
1ydiA           -SDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
1syqA           -SDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
1rkeA           -SDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
1rkcA           -SDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
2hsqA           -SDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN


                         .         .         +         .         .         .         .:490
query           LPQGMTSLLAFDPSKSIEENQERMTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1zw2A           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
1zvzA           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
1xwjA           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
1u6hA           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
1t01A           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
1st6A           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
2gdcA           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
1ydiA           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
1syqA           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
1rkeA           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
1rkcA           LGPGMTKM-----AKMIDERQQELT---------------------------------------------
2hsqA           LGPGMTKM-----AKMIDERQQELT---------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1zw2A           -----------------------------------------------------------------
1zvzA           -----------------------------------------------------------------
1xwjA           -----------------------------------------------------------------
1u6hA           -----------------------------------------------------------------
1t01A           -----------------------------------------------------------------
1st6A           -----------------------------------------------------------------
2gdcA           -----------------------------------------------------------------
1ydiA           -----------------------------------------------------------------
1syqA           -----------------------------------------------------------------
1rkeA           -----------------------------------------------------------------
1rkcA           -----------------------------------------------------------------
2hsqA           -----------------------------------------------------------------