[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:asd

[Show Plain Result]

#ERROR : Can't open dsspfile "2gz1A.bssp"
#ERROR : Can't open dsspfile "2gz3C.bssp"
#ERROR : Can't open dsspfile "2gyyA.bssp"
#ERROR : Can't open dsspfile "2gz3B.bssp"
#ERROR : Can't open dsspfile "2gyyC.bssp"
#ERROR : Can't open dsspfile "2gyyD.bssp"
#ERROR : Can't open dsspfile "2gyyB.bssp"
#ERROR : Can't open dsspfile "2qz9B.bssp"
#ERROR : Can't open dsspfile "2qz9A.bssp"
#ERROR : Can't open dsspfile "2r00C.bssp"
#ERROR : Can't open dsspfile "2r00A.bssp"
#ERROR : Can't open dsspfile "2r00B.bssp"
#ERROR : Can't open dsspfile "2yv3A.bssp"
#ERROR : Can't open dsspfile "1ys4A.bssp"
#ERROR : Can't open dsspfile "2ep5D.bssp"
#ERROR : Can't open dsspfile "2ep5A.bssp"
#ERROR : Can't open dsspfile "1mb4A.bssp"
#ERROR : Can't open dsspfile "2hjsA.bssp"
#ERROR : Can't open dsspfile "1ta4A.bssp"
#ERROR : Can't open dsspfile "1nwcA.bssp"
#ERROR : Can't open dsspfile "1ps8A.bssp"
#ERROR : Can't open dsspfile "1pr3A.bssp"
#ERROR : Can't open dsspfile "1q2xA.bssp"
#ERROR : Can't open dsspfile "1pu2A.bssp"
#ERROR : Can't open dsspfile "1pquC.bssp"
#ERROR : Can't open dsspfile "1pquA.bssp"
#ERROR : Can't open dsspfile "1ozaA.bssp"
#ERROR : Can't open dsspfile "1nx6A.bssp"
#ERROR : Can't open dsspfile "1nwhA.bssp"
#ERROR : Can't open dsspfile "1t4bA.bssp"
#ERROR : Can't open dsspfile "1gl3A.bssp"
#ERROR : Can't open dsspfile "1pqpA.bssp"
#ERROR : Can't open dsspfile "1brmB.bssp"
#ERROR : Can't open dsspfile "1brmC.bssp"
#ERROR : Can't open dsspfile "1brmA.bssp"
#ERROR : Can't open dsspfile "3gnqB.bssp"
#ERROR : Can't open dsspfile "3gnqA.bssp"

## Summary of PDB Search
:358
    e-176  99%  2gz1A  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    e-174  99%  2gz3C  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    e-172  99%  2gyyA  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    e-170  99%  2gz3B  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    e-169  99%  2gyyC  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    e-167  99%  2gyyD  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    e-165  99%  2gyyB  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    5e-62  44%  2qz9B  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    5e-62  44%  2qz9A  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    1e-59  43%  2r00C  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    4e-55  45%  2r00A  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-53  46%  2r00B  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    6e-51  41%  2yv3A  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-22  34%  1ys4A  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-17  30%  2ep5D  [x.x.x] 350AA LONG HYPOTHETICAL ASPARTATE-SEMIALDEHYDE
    3e-17  30%  2ep5A  [x.x.x] 350AA LONG HYPOTHETICAL ASPARTATE-SEMIALDEHYDE
    1e-15  26%  1mb4A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-15  24%  2hjsA  [x.x.x] USG-1 PROTEIN HOMOLOG
    4e-12  29%  1ta4A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    4e-12  29%  1nwcA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    1e-11  29%  1ps8A  [c.2.1 - d.81.1] ASPARTATE SEMIALDEHYDE DEHYDROGENASE
    1e-11  29%  1pr3A  [c.2.1 - d.81.1] ASPARTATE SEMIALDEHYDE DEHYDROGENASE
    3e-11  29%  1q2xA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-11  29%  1pu2A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-11  29%  1pquC  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-11  29%  1pquA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-11  29%  1ozaA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-11  29%  1nx6A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-11  29%  1nwhA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    5e-11  32%  1t4bA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    5e-11  32%  1gl3A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    6e-11  29%  1pqpA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-09  32%  1brmB  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-09  32%  1brmC  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-09  32%  1brmA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    0.001  27%  3gnqB  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE, TYPE I
    0.001  27%  3gnqA  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE, TYPE I
:358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gz1A           ----------------QMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gz3C           ----------------QMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gyyA           ----------------QMIKMLEESTLPIDKIRYLAS----GKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gz3B           ----------------QMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gyyC           ----------------QMIKMLEESTLPIDKIRYL------GKSLKF-DQDXXXXXXXXXAFEGVDIALF
2gyyD           ----------------QMIKMLEESTLPIDKIRYL------GKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gyyB           ----------------QMIKMLEESTLPIDKIRYL-------------DQDXXXXXXXXXAFEGVDIALF
2qz9B           -----------------MLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2qz9A           -----------------MLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2r00C           -----------------MLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2r00A           -----------------MLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2r00B           -----------------MLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2yv3A           ----------------EILKVLEARNFPLSELRLYASPRSAGVRLAFRGXXXXXXXXXXXXXXXXXXXA-
1ys4A           ---------------------------PFELTALAASERSAGKKYKFQDRDIPENIKDVVIFEDVDIVFS
2ep5D           ----------------KMVKMLAKHPY-LELVKVSASPSKIGK--KYKDQDLPIVSTNYEDHKDVDVVLS
2ep5A           ----------------KMVKMLAKHPY-LELVKVSASPSKIGK--KYKDQDLPIVSTNYEDHKDVDVVLS
1mb4A           -----------------MQRMVEERDFDLIEPVFFSTSQIGVPAPNFKDAGMLHDAFDIESLKQLDAVIT
2hjsA           -----------------LVGLLDERDFPLHRLHLLASAESAGQR-GFAESSLRVGDVDSFDFSSVGLXXX
1ta4A           ----------------------------------------------------------------------
1nwcA           ----------------------------------------------------------------------
1ps8A           ----------------------------------------------------------------------
1pr3A           ----------------------------------------------------------------------
1q2xA           ----------------------------------------------------------------------
1pu2A           ----------------------------------------------------------------------
1pquC           ----------------------------------------------------------------------
1pquA           ----------------------------------------------------------------------
1ozaA           ----------------------------------------------------------------------
1nx6A           ----------------------------------------------------------------------
1nwhA           ----------------------------------------------------------------------
1t4bA           ----------------------------------------------------------------------
1gl3A           ----------------------------------------------------------------------
1pqpA           ----------------------------------------------------------------------
1brmB           ----------------------------------------------------------------------
1brmC           ----------------------------------------------------------------------
1brmA           ----------------------------------------------------------------------
3gnqB           ---------------------------------------------------------------GVDVVME
3gnqA           ---------------------------------------------------------------GVDVVME


                         .         .         *         .         .         .         .:140
query           SAGSSTSAXYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
2gz1A           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
2gz3C           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
2gyyA           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
2gz3B           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
2gyyC           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
2gyyD           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
2gyyB           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
2qz9B           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIARNRNIIANPNCSTIQMLVALKPI
2qz9A           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIARNRNIIANPNCSTIQMLVALKPI
2r00C           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIARNRNIIANPN-STIQMLVALKPI
2r00A           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIARNRNIIANPNCSTIQMLVALKPI
2r00B           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIARNRNIIANPNCSTIQMLVALKPI
2yv3A           SAGGGISRAKALVWAEGGALVVDNSSAWRYEPWVPLVVPEVNREKIFQHRGIIANPNCTTAILAMALWPL
1ys4A           ALPSDLAKKFEPEFAKEGKLIFSNASAYREE-DVPLVIPEVNADHLELDGAIITNPNCSTICAVITLKPI
2ep5D           ALPNELAESIELELVKNGKIVVSNASPFRMDPDVPLINPEINWEHLEGWKGIVKNPNCTAAIMSMPIKPL
2ep5A           ALPNELAESIELELVKNGKIVVSNASPFRMDPDVPLINPEINWEHLEGWKGIVKNPNCTAAIMSMPIKPL
1mb4A           CQGGSYTEKVYPALRQAGWYWIDAASTLRMDKEAIITLDPVNLHGIHHGTKTFVGGNCTVSLMLMALGGL
2hjsA           XXXXXXXXXXXXXXXXXGCSVIDLSGALEXXXXXXXXXXNAERLASQAAPFLLSSPCAVAAELCEVLAPL
1ta4A           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIFVGGNCTVSLMLMAIGGL
1nwcA           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIFVGGNCTVSLMLMAIGGL
1ps8A           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIFVGGNCTVSLMLMAIGGL
1pr3A           ---------------------VDAASALKMKDDAIIVLDPVNQHVISEKKGIFVGGNCTVSLMLMAIGGL
1q2xA           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIKTFVGGNTVSLMLAIGGL
1pu2A           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIKTFVGGNTVSLMLAIGGL
1pquC           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIFVGGNCTVSLMLMAIGGL
1pquA           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIFVGGNCTVSLMLMAIGGL
1ozaA           ---------------------VDAASALLMKDDAIIVLDPVNQHVISEKKGIFVGGNCTVSLMLMAIGGL
1nx6A           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIKTFVGGNTVSLMLAIGGL
1nwhA           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIKTFVGGNTVSLMLAIGGL
1t4bA           ---------------------IDAASSLRMKDDAIIILDPVNQDVITLNNGIFVGGNCTVSLMLMSLGGL
1gl3A           ---------------------IDAASSLRMKDDAIIILDPVNQDVITLNNGIFVGGNCTVSLMLMSLGGL
1pqpA           ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIFVGGNSTVSLMLMAIGGL
1brmB           ---------------------IDAASSLRMKDDAIIILDPVNQDVITLNNGIFVGGNCTVSLMLMSLGGL
1brmC           ---------------------IDAASSLRMKDDAIIILDPVNQDVITLNNGIFVGGNCTVSLMLMSLGGL
1brmA           ---------------------IDAASSLRMKDDAIIILDPVNQDVITLNNGIFVGGNCTVSLMLMSLGGL
3gnqB           CTGFFTSKEKASAHLKGGAKKVIISAPGGKDVDATIVYG-VNHDVLKAEHTVISNASCTTNCLAPLVKPL
3gnqA           CTGFFTSKEKASAHLKGGAKKVIISAPGGKDVDATIVYG-VNHDVLKAEHTVISNASCTTNCLAPLVKPL


                         +         .         .         .         .         *         .:210
query           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPRDLHAEILPSGGDKKHYPIAFNALPQID
2gz1A           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQID
2gz3C           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQID
2gyyA           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQID
2gz3B           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQID
2gyyC           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQID
2gyyD           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQID
2gyyB           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQID
2qz9B           YDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNG-----------YPAETNTFSQQIAFNCIPQID
2qz9A           YDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNG-----------YPAETNTFSQQIAFNCIPQID
2r00C           YDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNG-----------YPAETNTFSQQIAFNCIPQID
2r00A           YDAVGIERINVTTYQSVSGAGKAGI----------------------------------------DPQID
2r00B           YDAVGIERINVTTYQSV---------ETNTFSQQ--------------------------IAFNCIPQID
2yv3A           HRAFQAKRVIVATYQAASGAGAKAMEELLTETHRFLHGEAPKAEAFA-----------HPLPFNVIPHID
1ys4A           -DKFGLEAVFIAT-QAVSGAGYNGV----------------PSAILDNLIPF--IKNEEEKQTESLKLLG
2ep5D           IEIATKSKIIITTLQAVSGAGYNGI-------------------------------SFMAIEGNIIPYIK
2ep5A           IEIATKSKIIITTLQAVSGAGYNGI-------------------------------SFMAIEGNIIPYIK
1mb4A           YERGLVEWMSAMTYQAASGAGAQNMRELISQMG-VINDAVSSELANAETMRSGSDNFGVPLAGSLIPWID
2hjsA           LATLDCRQLNLTACLSVSSLGREGVKELARQTAELLN----ARPLEPRLF----DRQ---IAFNLLAQVG
1ta4A           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1nwcA           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1ps8A           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1pr3A           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1q2xA           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1pu2A           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1pquC           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1pquA           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1ozaA           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1nx6A           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1nwhA           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1t4bA           FANDLVDWVSVATYQAASGGGMGAILDIERKVTTLTRSGELPVDNFG-----------VPLAGSLIPWID
1gl3A           FANDLVDWVSVATYQAASGGGMGAILDIERKVTTLTRSGELPVDNFG-----------VPLAGSLIPWID
1pqpA           FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
1brmB           FANDLVDWVSVATYQAASGGGMGAILDIERKVTTLTRSGELPVDNFG-----------VPLAGSLIPWID
1brmC           FANDLVDWVSVATYQAASGGGMGAILDIERKVTTLTRSGELPVDNFG-----------VPLAGSLIPWID
1brmA           FANDLVDWVSVATYQAASGGGMGAILDIERKVTTLTRSGELPVDNFG-----------VPLAGSLIPWID
3gnqB           NDKIGLETGLMTTIHA------------------------------------------------------
3gnqA           NDKIGLETGLMTTIHA------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
2gz1A           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
2gz3C           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
2gyyA           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
2gz3B           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
2gyyC           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
2gyyD           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
2gyyB           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
2qz9B           QFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIE
2qz9A           QFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIE
2r00C           QFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIE
2r00A           QFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIE
2r00B           QFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIE
2yv3A           AFQENGYTREEMKVVWETHKIFGDDTIRISATAVRVPTLRAHAEAVSVEFARPVTPEAAREVLKEAPGVE
1ys4A           TLKDGKVELA---------------NFKISASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVLPTYAKPI
2ep5D           GEEDKIAKELTKLNGKLENNQIIPANLDSTVTSIRVPTRVGHMGVINIVTNERINIEEIKKTLKNFKSLP
2ep5A           GEEDKIAKELTKLNGKLENNQIIPANLDSTVTSIRVPTRVGHMGVINIVTNERINIEEIKKTLKNFKSLP
1mb4A           VKRDNSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWV
2hjsA           AVDAEGHSAIERRIFAEVQALLGERIGPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKGI-
1ta4A           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1nwcA           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1ps8A           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVKIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1pr3A           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1q2xA           KLTGQTKDEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1pu2A           KLTGQTKEEWRGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1pquC           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCNSQAFTIKLKKDLPLEEIEQIIASHNEKV
1pquA           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCNSQAFTIKLKKDLPLEEIEQIIASHNEKV
1ozaA           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1nx6A           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1nwhA           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1t4bA           KQLDNGQSREEWKGQAETNKILNTSSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHPWAV
1gl3A           KQLDNGQSREEWKGQAETNKILNTSSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHPWAV
1pqpA           KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
1brmB           EWKGQ---------AETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHPWAV
1brmC           -------KEEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHPWAV
1brmA           ----------WKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHPWAV
3gnqB           ----------------------------------------------------------------------
3gnqA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
2gz1A           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
2gz3C           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
2gyyA           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
2gz3B           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVR--
2gyyC           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
2gyyD           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
2gyyB           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
2qz9B           L---FRGADFPTQVRDAGGKDVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELL---------
2qz9A           L---FRGADFPTQVRDAGGKDVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELL---------
2r00C           L---FRGADFPTQVRDAGGKDVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELL---------
2r00A           L---FRGADFPTQVRDAGGKDVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELL---------
2r00B           LADFPTH--------------VLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELL---------
2yv3A           VVDEPEAKRYPMPLTASGKWDVEVGRIRKSLAFENGLDFFVVGDQLLKGAALNAVQIAE-----------
1ys4A           VIREEIDRPQPRLDRNEGNGSIVVGRIRKDPIFD--VKYTALEHNTIRGAAGASVLNAE-----------
2ep5D           QQKNLPEEDRPQPINAESGMAVTVGRIRHENNV---LRLVVLGDNLVRGAAGITILTVEVMKELGYI---
2ep5A           QQKNLPEEDRPQPINAESGMAVTVGRIRHENNV---LRLVVLGDNLVRGAAGITILTVEVMKELGYI---
1mb4A           KRDITARELTPAKV--TGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAA-------------------
2hjsA           --EWVGEGDYPTVVDALGQDETYVGRVRAGQADPCQVNLWIVSDNVRKGAALNAVLLGELL---------
1ta4A           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1nwcA           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1ps8A           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1pr3A           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1q2xA           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1pu2A           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1pquC           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1pquA           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1ozaA           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1nx6A           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1nwhA           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1t4bA           VPNDTMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
1gl3A           VPNDTMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
1pqpA           IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
1brmB           VPNDTMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
1brmC           VPNDTMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
1brmA           VPNDTMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
3gnqB           ----------------------------------------------------------------------
3gnqA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AELKFELK
2gz1A           AELKFELK
2gz3C           --LKFELK
2gyyA           AELKFEL-
2gz3B           --------
2gyyC           AELKFELK
2gyyD           --------
2gyyB           AELKFE--
2qz9B           --------
2qz9A           --------
2r00C           --------
2r00A           --------
2r00B           --------
2yv3A           --------
1ys4A           --------
2ep5D           --------
2ep5A           --------
1mb4A           --------
2hjsA           --------
1ta4A           --------
1nwcA           --------
1ps8A           --------
1pr3A           --------
1q2xA           --------
1pu2A           --------
1pquC           --------
1pquA           --------
1ozaA           --------
1nx6A           --------
1nwhA           --------
1t4bA           --------
1gl3A           --------
1pqpA           --------
1brmB           --------
1brmC           --------
1brmA           --------
3gnqB           --------
3gnqA           --------