[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56217.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"

## Summary of PDB Search
:581
    5e-83  35%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    4e-68  32%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    6e-59  29%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-56  30%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-56  30%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-51  41%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    3e-46  42%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    3e-46  42%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-46  42%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-46  42%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-46  42%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-45  41%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    4e-45  41%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-45  41%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    4e-45  41%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-43  30%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    4e-42  43%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    5e-37  36%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    5e-37  36%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    1e-33  42%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    5e-32  35%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    6e-32  34%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-31  34%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-31  34%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-30  35%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-29  33%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-25  34%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-23  32%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-23  32%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-23  33%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    9e-23  32%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-23  32%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  32%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  32%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  33%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-22  31%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-22  31%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-22  31%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-21  33%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-21  33%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-21  31%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-21  31%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-21  31%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-20  29%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-20  29%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-20  32%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    2e-20  29%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-19  30%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-19  30%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-19  31%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-18  28%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-18  28%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-18  29%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-18  30%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-18  30%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    4e-18  30%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-18  30%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-18  30%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-18  31%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    9e-18  29%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-16  29%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-16  29%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-15  29%  2oukB  [x.x.x] PROTEIN ARTP
    1e-15  29%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    1e-15  28%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-15  28%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-15  29%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-15  29%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    4e-15  29%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-15  29%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-15  29%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-15  27%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-15  29%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    7e-15  29%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-15  29%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-15  28%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-14  28%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    3e-14  26%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-14  26%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-13  30%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-13  26%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    1e-12  32%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-12  27%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    2e-12  30%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-12  25%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    7e-12  27%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    1e-11  30%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-11  30%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-11  29%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-11  31%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    4e-11  31%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    1e-10  32%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    2e-10  29%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-10  30%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-10  30%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    5e-10  25%  2d2fA  [x.x.x] SUFC PROTEIN
    7e-10  26%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-10  30%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-10  27%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    9e-10  28%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-09  24%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    4e-09  24%  2d2eA  [x.x.x] SUFC PROTEIN
    6e-09  25%  1ji0A  [c.37.1] ABC TRANSPORTER
    7e-09  24%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    7e-09  24%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    1e-08  30%  1yqtA  [x.x.x] RNASE L INHIBITOR
    1e-08  28%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-07  27%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    9e-07  27%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    5e-06  28%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    1e-05  32%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-04  25%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-04  31%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-04  25%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-04  25%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-04  40%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    4e-04  40%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
:581

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxQKLWWFFKLEKRRYLVGIVALILVSVLNLIPPMVMGRVIDAITSGXXXXXXXXXXXXXXXXAAFGM
2hydA           ----------------------------------------------------------------------
1pf4A           ----KRLWTYIRLYKAGLVVSTIALVINAAADTYMISLLKPLLDE--------GFGNAESNFLRILPFMI
3b60A           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHATNDINALTRLAGGGVMSAVD
2hydA           ---------------------IRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTGLMNIWL
1pf4A           LGLMFVRGLSGFASSYCLSWVMRRRLFNHFMHMPVRFFDQESTGGLLSRITYDSEQVAGATSRALVSIVR
3b60A           -------------SSYCISWVMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVR
3g60A           ---------YIQVSFWCLAQIIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQ
3g5uA           ---------YIQVSFWCLAQIIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQ
2ghiA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           -------------SSYCISWVMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVR
2ghiD           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGRKTHKAFGESQAAFSELNNKVQESVSGIKVT
2hydA           DCITIIIALSIMFF-LDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERSQALAEVQGFLHERVQGISVV
1pf4A           EG-ASIIGLLTLMFWNSWQLSLVLIVVAPVVAFAISFVSKRFRKISRNMQTAMGHR--------------
3b60A           EG-ASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEV
3g60A           A-MAXXXXXXXXXXXXXWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTV
3g5uA           A-MAXXXXXXXXXXXXXWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTV
2ghiA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           EG-ASIIGLFIMMFYYSWQLSIILVVLAPIVSIAIRVVSKR-----------FRSISKNMQNTMG--QVT
2ghiD           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KSFGYQADELKSFQAVNELTFQKNLQTMKYDSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTF
2hydA           KSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAF
1pf4A           ---------------------QQTMKLVSAQSIADPVIQMIXXXXXXXXXXXXXXDSIRAELTPGTFTVV
3b60A           LIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVV
3g60A           IAFGGQKKELERYN--NNLEEAKRLGIKKAITANISMAFLLIYASYALAFWYGTSLVISKEYSIGQVLTV
3g5uA           IAFGGQKKELERYN--NNLEEAKRLGIKKAITANISMAFLLIYASYALAFWYGTSLVISKEYSIGQVLTV
2ghiA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           TS----AERLQGMKMVSA------------SSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVV
2ghiD           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ISYLDMLVWPLMAIGFLFNTTQRGKVSYQRIENLLSQESPVQDPEFPLDGIENGRLEYAIDSFAFENEET
2hydA           VGYLELLFGPLRRLVASFTTLTQSFASMDRVFQLIDEDYDIKNGAQPIE-IKQGRIDIDHVSFQYNDNEA
1pf4A           FSAMFGLMRPLKALTSVTSEFQRGMAACQTLFGLMDLETERDNGKYEAERV-NGEVDVKDVTFTYQGKEA
3b60A           FSSMIALMRPLKSLTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRA-TGDLEFRNVTFTYPGREV
3g60A           --FFSVLIGAFSVIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKP-DNIQ-GNLEFKNIHFSYPSRQI
3g5uA           --FFSVLIGAFSVIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKP-DNIQ-GNLEFKNIHFSYPSRQI
2ghiA           -------------------------------------------------------IEFSDVNFSYPNHRT
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
2ghiC           -------------------------------------------------------IEFSDVNFSYPNHRT
1xefA           ----------------------------------------------------------------------
2ghiB           -------------------------------------------------------IEFSDVNFSYPNHRT
2ffaA           ----------------------------------------------------------------------
1z2rA           FSSMIALMRPLKSLTNVNAQFQRGMAA-----------------------------EFRNVTFTYPGREV
2ghiD           ----------------------------------------------------------------FSYHRT
1mv5D           --------------------------------------------------------------FAYDDEQI
1mv5A           --------------------------------------------------------------FAYDDEQI
2cbzA           -------------------------------------------------------------TWARSDPPT
1jj7A           -----------------------------------------------------GLVQFQDVSFAYPNRPV
2ixfA           --------------------------------------SPLSGSLAPLN--MKGLVKFQDVSFAYPNHQV
2ixfC           -----------------------------------------------------GLVKFQDVSFAYPNHQV
2ixeA           -----------------------------------------------------GLVKFQDVSFAYPNHQV
2ixfD           -----------------------------------------------------GLVKFQDVSFAYPNHQV
2ixgA           -----------------------------------------------------GLVKFQDVSFAYPNHQV
2ixeD           -----------------------------------------------------GLVKFQDVSFAYPNHQV
1r0xB           -------------------------------------------------------LEKSFSHLCLVGNPV
1r0xA           -------------------------------------------------------LEKSFSHLCLVGNPV
2onkA           ----------------------------------------------------------------------
1q3hD           -------------------------------------------------------LEKVFSHLCLVGNPV
1q3hC           -------------------------------------------------------LEKVFSHLCLVGNPV
1r0wB           -----------------------------------------------------GELLEKVQSFSLVGNPV
1r0wA           -----------------------------------------------------GELLEKVQSFSLVGNPV
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9B           -------------------------------------------------------LEKSFSHLCLVGNPV
1xf9A           -------------------------------------------------------LEKSFSHLCLVGNPV
1xfaA           -------------------------------------------------------LEKSFSHLCLVGNPV
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
1xmiE           --------------------------------------------------------EKSFSNFSLLGTPV
1xmiA           --------------------------------------------------------EKSFSNFSLLGTPV
3d31A           ---------------------------------------------------------------------S
1xmiC           ----------------------------------------------------------SFSNFSLLGTPV
2pzfA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiD           ---------------------------------------------------EEGFGELFEDSLSFSNTPV
2yz2B           -------------------------------------------------------------------KKA
2yz2A           -------------------------------------------------------------------KKA
1xmjA           ---------------------------------------------------------------AFWETPV
2it1B           ----------------------------------------------------------------FGNFTA
2it1A           ----------------------------------------------------------------FGNFTA
2pzgB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3dhwC           --------------------------------------------------------------------QA
2bbtB           ------------------------------------------------------------------NTPV
1xmiB           ----------------------------------------------------------SFSNFSLLGTPV
2bbsA           ----------------------------------------------------------------------
2oukB           ---------------------------------------------------------------SFGSLEV
2oljA           ---------------------------------------------------------------SFGSLEV
3fvqB           -------------------------------------------------------------SKSFQNTPV
3fvqA           -------------------------------------------------------------SKSFQNTPV
1g9xA           ----------------------------------------------------------------FGEFKA
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------FGKVKA
1gajA           ----------------------------------------------------------------FGEFKA
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           -------------------------------------------------------------SVQLQNVTV
1g6hA           ----------------------------------------------------------------FGEFKA
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2nq2C           --------------------------------------------------VENLGFYYQAENFLFQQ---
1g291           ----------------------------------------------------------------FGEVTA
2awnC           -------------------------------------------------------------SVQLQNVTV
2pcjA           --------------------------------------------------------------------EI
2nq2D           --------------------------------------------------------------------QA
1v43A           ----------------------------------------------------------------FGNFTA
3gfoA           -----------------------------------------------------------------DGTHA
2zu0C           -----------------------------------------------------------------EDKAI
2d3wA           -----------------------------------------------------------------EDKAI
2d3wB           -----------------------------------------------------------------EDKAI
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3bk7A           --------------------------------------------------VEYPRLVKDYGSFKLEVEPG
2d3wD           -----------------------------------------------------------------EDKAI
2d62A           ----------------------------------------------------------------FGDVTA
2d2fA           ---------------------------------------------------------------SIDGETI
1vplA           ----------------------------------------------------------------------
2ihyB           -----------------------------------------------------------------QGKTI
2d3wC           -----------------------------------------------------------------EDKAI
1f3oA           ----------------------------------------------------------------------
1sgwA           ------------------------------------------------------------------DKPV
2d2eA           ---------------------------------------------------------------SIDGETI
1ji0A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2ihyA           -----------------------------------------------------------------QGKTI
2qi9C           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LTDIHFSLAKGQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIXLNGHDIRDYRLTDLRSLMGYVPQDQFL
2hydA           LKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQDNIL
1pf4A           LSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKLTNLRRHFALVSQNVHL
3b60A           LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALVSQNVHL
3g60A           LKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVL
3g5uA           LKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVL
2ghiA           LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNSIRSIIGIVPQDTIL
1mt0A           LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVL
2ff7A           LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVL
3b5jA           LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVL
2fgkA           LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVL
2ffbA           LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVL
2ghiC           LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNSIRSIIGIVPQDTIL
1xefA           LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVL
2ghiB           LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNSIRSIIGIVPQDTIL
2ffaA           LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVL
1z2rA           LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALVSQNVHL
2ghiD           LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNSIRSIIGIVPQDTIL
1mv5D           LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAI
1mv5A           LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAI
2cbzA           LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGS-------------VAYVPQQAWI
1jj7A           LQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQV
2ixfA           LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLL
2ixfC           LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLL
2ixeA           LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLL
2ixfD           LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAV--GQLL
2ixgA           LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLL
2ixeD           LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAV--GPLL
1r0xB           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0xA           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
2onkA           ---------------LLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITP--LPPERRGIGFVPQDYAL
1q3hD           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1q3hC           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0wB           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0wA           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r10A           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0zD           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0zC           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0zB           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0zA           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0xD           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0xC           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1r0wC           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1q3hB           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1q3hA           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1xf9B           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1xf9A           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1xfaA           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1xf9D           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
1xf9C           LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-------------VSFCSQFSWI
2pzeA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
2pzgA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
2pzeB           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
1xmiE           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
1xmiA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
3d31A           LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTD--LSPEKHDIAFVYQNYSL
1xmiC           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
2pzfA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
2pzfB           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
2bboA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
1xmiD           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
2yz2B           LENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIRRNIGIAFQYPEDQF-
2yz2A           LENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIRRNIGIAFQYPEDQF-
1xmjA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
2it1B           LNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRN--VGLVFQNWAL
2it1A           LNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRN--VGLVFQNWAL
2pzgB           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
2bbtA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQNSWI
2bbsB           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQNSWI
3dhwC           LNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTESELTKARRQIGMIFQHFNL
2bbtB           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQNSWI
1xmiB           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQFSWI
2bbsA           LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-------------ISFCSQNSWI
2oukB           LKGINVHIREGEVVVVIGPSGSGKSTFLRCLLEDFXXXXXXXXXXNLKAKDTNLNKVREEVGMVFQRFNL
2oljA           LKGINVHIREGEVVVVIGPSGSGKSTFLRCLLEDFXXXXXXXXXXNLKAKDTNLNKVREEVGMVFQRFNL
3fvqB           LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIKNTNLPVRERRLGYLVQEGVL
3fvqA           LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIKNTNLPVRERRLGYLVQEGVL
1g9xA           LDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYGIVRTFQTPQPL
1q12A           --DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERG--VGMVFQSYAL
3fh6A           --DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERG--VGMVFQSYAL
2awoA           --DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERG--VGMVFQSYAL
2awnB           --DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERG--VGMVFQSYAL
2yyzA           VDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVND--IPPKYREVGMVFQNYAL
1gajA           LDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYGIVRTFQTPQPL
2r6gB           --DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERG--VGMVFQSYAL
2r6gA           --DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERG--VGMVFQSYAL
2awoC           SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG-----EKRMNDTPPAERGVGMVALY
1g6hA           LDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYGIVRTFQTPQPL
1l2tB           LKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNNDLDDDELTKIRDKIGFVFQQFNL
1l2tA           LKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNNDLDDDELTKIRDKIGFVFQQFNL
2nq2C           ---LNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI-------------EVYQSIGFVPQFSSP
1g291           VREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIG-----DKLVADPEKGIFVPPKDRDI
2awnC           SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIA-------------GLGV------------GMVFQSYAL
2pcjA           LKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEV-DYELSLLRNRLGFVFQFHYL
2nq2D           FQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI-------------EVYQSIGFVPQFSSP
1v43A           VNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHM----
3gfoA           LKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPI-DYSIMKLRESIGIVFQDNQL
2zu0C           LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPED-RAGEGIFMAFQYP
2d3wA           LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPED-RAGEGIFMAFQYP
2d3wB           LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPED-RAGEGIFMAFQYP
1oxvA           LDNVNINIENGERFGILGPSGAGKTTFMRIIAG-LDVPS-----TGELYFDDRLVASNGKLIVPPEDRMV
1oxsC           LDNVNINIENGERFGILGPSGAGKTTFMRIIAG-LDVPS-----TGELYFDDRLVASNGKLIVPPEDRMV
1b0uA           ----------------------------------------------------------------------
3bk7A           ------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKV--------EWDLT-----VAYKPQ----
2d3wD           LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPED-RAGEGIFMAFQYP
2d62A           VKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLE-EPTRGQIYIEDNLVADPEFVPPKERDVAVFQSYAL
2d2fA           LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAPEYTVERGEILLDGENILELS-PDERARKGLFLAFQYP
1vplA           --------------------GAGKTTTLRIISTLIKPSSGIVTVFGKNVVE-EPHEVRKLISYLPEEAGA
2ihyB           LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGKGYSAETVRQHIGFV------
2d3wC           LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGKDLLALSPED-RAGEGIFMAFQYP
1f3oA           LKNVNLNIKEGEFVS-IGPSGSGKSTLIGCLDKPTEGEVYIDNIKTNDLDDDELTKIRDKIGFVFQQFNL
1sgwA           LERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPI-----TKVKGKIFFLPEEIIV
2d2eA           LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAPEYTVERGEILLDGENILELS-PDERARKGLF----LA
1ji0A           ---IDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINRGIALVPEGRRI
1z47B           ---VSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTD--LPPQKRNVGLVFQNYAL
1z47A           ---VSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTD--LPPQKRNVGLVFQNYAL
1yqtA           -------IKKGEVIGIVGPNGIGKTTFVKLAGVE-EPTEGKI--------EWDLT-----VAYKPQ--YI
2ihyA           LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKP--GYSAETVRQHIGFV------
2qi9C           ----------GEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQ--
1l7vC           ----------GEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQ--
2pjzA           ----------GEKVIILGPNGSGKTTLLRAILLPYS---GNIFINGMEVRKIR-------------NYIR
2awnA           ----------------------------------------------------------------------
1oxxK           LDNVNINIENGERFGILGPSGAGKTTFMRIIA---GLD---VPSTGELYFDDRLVASNGKLIVPPEDRMV
2awnD           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FATSILDNIRFGNPNLPLSAVVEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRLAMSRAMILEP
2hydA           FSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNP
1pf4A           FNDTIANNIAYAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVAIARALLRDA
3b60A           FNDTVANNIAYARTEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXXXXXXXXXXXXXXDS
3g60A           FATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNP
3g5uA           FATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNP
2ghiA           FNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDP
1mt0A           LNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNP
2ff7A           LNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNP
3b5jA           LNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNP
2fgkA           LNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNP
2ffbA           LNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNP
2ghiC           FNETIKYNILYGKLDAT-EEVIKATKSAQLYDFIEALPKKWDTIVG--GMKL--GERQRIAIARCLLKDP
1xefA           LNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNP
2ghiB           FNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNK-MKLSGGERQRIAIARCLLKDP
2ffaA           LNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNP
1z2rA           FNDTVANNIAYATEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXXXXXXXXXXXXXXDS
2ghiD           FNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIV------LSGGERQRIAIARCLLKDP
1mv5D           MAGTIRENLTYGEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNP
1mv5A           MAGTIRENLTYGEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNP
2cbzA           QNDSLRENILFGCQEPYYRSVIQACALL---PDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNA
1jj7A           FGRSLQENIAYGLTQKPMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKP
2ixfA           FGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISFPQGYDTEVGETGNQLSGGQRQAVALARALIRKP
2ixfC           FGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISFPQGYDTEVGETGNQLSGGQRQAVALARALIRKP
2ixeA           FGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISFPQGYDTEVGETGNQLSGGQRQAVALARALIRKP
2ixfD           FGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISFPQGYDTEVGETGNQLSGGQRQAVALARALIRKP
2ixgA           FGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISFPQGYDTEVGETGNQLAVGQRQAVALARALIRKP
2ixeD           FGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISFPQGYDT-----EVQLSGGQRQAVALARALIRKP
1r0xB           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0xA           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
2onkA           FPLSVYRNIAYG-------LXXXXXXXXXXXXXXMAEKLGIAHLLDRKPARLSGGERQRVALARALVIQP
1q3hD           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1q3hC           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0wB           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0wA           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r10A           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0zD           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0zC           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0zB           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0zA           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0xD           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0xC           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1r0wC           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1q3hB           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1q3hA           MPGTIKENIIFGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1xf9B           MPGTIKENIISGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1xf9A           MPGTIKENIISGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1xfaA           MPGTIKENIIRGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1xf9D           MPGTIKENIISGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
1xf9C           MPGTIKENIISGYDEYRYKSVVKACQLQ---QDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA
2pzeA           MPGTIKENIIFGYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDA
2pzgA           MPGTIKENIIFGYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDA
2pzeB           MPGTIKENIIFGYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDA
1xmiE           MPGTIKENIIAGYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDA
1xmiA           MPGTIKENIIAGYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDA
3d31A           FPMNVKKNLEFG---MRMKKIKDPKRVLDTARDLK-----IEHLLDRNPLTLSGGEQQRVALARALVTNP
1xmiC           MPGTIKENIIAGYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDA
2pzfA           MPGTIKENIGVSYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDA
2pzfB           MPGTIKENIGVSYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDA
2bboA           MPGTIKENIIFGYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDA
1xmiD           MPGTIKENIIAGYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGE--ITLSGGQRARISLARAVYKDA
2yz2B           FAERVFDEVAFAVKNFPDRDPVPLVKKAMEFVGL-----DFDSFKDRVPFFLSGGEKRRVAIASVIVHEP
2yz2A           FAERVFDEVAFAVKNFPDRDPVPLVKKAMEFVGL-----DFDSFKDRVPFFLSGGEKRRVAIASVIVHEP
1xmjA           MPGTIKENIGVSYDEYRYRSVIKACQLE---EDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDA
2it1B           YPMTVYKNIAF-----PLELKAPREEIDKKVREVAKMLH-IDKLLNRYPWQLSGGQQQRVAIARALVKEP
2it1A           YPMTVYKNIAF-----PLELKAPREEIDKKVREVAKMLH-IDKLLNRYPWQLSGGQQQRVAIARALVKEP
2pzgB           MPGTIKENIIFGYDEYRYRSVIKACQLE---EDISKFAEKDNIVL---GITLSGGQRARISLARAVYKDA
2bbtA           MPGTIKENIGVSYDEYRYRSVIKACQLE---EDISKFAEKDNIVLG--GITLSGGQRARISLARAVYKDA
2bbsB           MPGTIKENIGVSYDEYRYRSVIKACQLE---EDISKFAEKDNIVLG--GITLSGGQRARISLARAVYKDA
3dhwC           LSSRTV----FGNVALPLE--LDNTPKDEVKRRVTELLSLVG--LGDKHDSLSGGQKQRVAIARALASNP
2bbtB           MPGTIKENIGVSYDEYRYRSVIKACQLE---EDISKFAEKDNIVL---GITLSGGQRARISLARAVYKDA
1xmiB           MPGTIKENIIAGYDEYRYRSVIKACQLEEDISKIV--------------LTLSGGQRARISLARAVYKDA
2bbsA           MPGTIKENIGVSYDEYRYRSVIKACQLE---EDISKFAEKDNIVL----ITLSGGQRARISLARAVYKDA
2oukB           FPMTVLNNITLAPMKVRKWPREKAEAKAMELLDKV----GLKDKAHAYPDSLSGGQAQRVAIARALAMEP
2oljA           FPMTVLNNITLAPMKVRKWPREKAEAKAMELLDKV----GLKDKAHAYPDSLSGGQAQRVAIARALAMEP
3fvqB           FPLTVYRNIAYGLGNGKGRTAQERQRIEAMLE-----LTGISELAGRYPHELSGGXXXXXXXXXXXXPDP
3fvqA           FPLTVYRNIAYGLGNGKGRTAQERQRIEAMLE-----LTGISELAGRYPHELSGGXXXXXXXXXXXXPDP
1g9xA           KEMTVLENLLIGEINSPLNSLFEMVEKAFKILEFLKLSHLYDRKAGE----LSGGQMKLVEIGRALMTNP
1q12A           YPLSVAENMSFG---LKLAGAKKEVINQRVNQ-VAEVLQ-LAHLLDRKPKALSGGQRQRVAIGRTLVAEP
3fh6A           YPLSVAENMSFG---LKLAGAKKEVINQRVNQ-VAEVLQ-LAHLLDRKPKALSGGQRQRVAIGRTLVAEP
2awoA           YPLSVAENMSFG---LKLAGAKKEVINQRVNQ-VAEVLQ-LAHLLDRKPKALSGGQRQRVAIGRTLVAEP
2awnB           YPLSVAENMSFG---LKLAGAKKEVINQRVNQ-VAEVLQ-LAHLLDRKPKALSGGQRQRVAIGRTLVAEP
2yyzA           YPMTVFENIAF-----PLRA--RRISKDEVEKRVVEIARKLDNLLDRKPTQLSGGQQQRVALARALVKQP
1gajA           KEMTVLENLLIGEINSPLNSLFEMVEKAFKILEFLKLSHLYDRKAGE----LSGGQMKLVEIGRALMTNP
2r6gB           YPLSVAENMSFG---LKLAGAKKEVINQRVNQ-VAEVLQ-LAHLLDRKPKALSGGQRQRVAIGRTLVAEP
2r6gA           YPLSVAENMSFG---LKLAGAKKEVINQRVNQ-VAEVLQ-LAHLLDRKPKALSGGQRQRVAIGRTLVAEP
2awoC           PHLSVAENMSFG---LKLAGAKKEVINQRVNQ-VAEVLQ-LAHLLDRKPKALSGGQRQRVAIGRTLVAEP
1g6hA           KEMTVLENLLIGEGESPLNSLFEMVEKAFKILEFLKLSHLYDRKAGE----LSGGQMKLVEIGRALMTNP
1l2tB           IPLTALENVE-----LPLRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNP
1l2tA           IPLTALENVE-----LPLRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNP
2nq2C           FAYSVLDIVLMGRSTKPKSHDYQVAMQALDYLNLTHLAK-------REFTSLSGGQRQLILIARAIASEC
1g291           AMVTVYDNIAF-----PLKLKVPRQEIDQRVREVAEL-LGLTELLNRKPRELSGGQRQRVALGRAIVRKP
2awnC           YPLSVAENMSFG---LKLAGAKKEVINQRVNQ-VAEVLQ-LAHLLDRKPKALSGGQRQRVAIGRTLVAEP
2pcjA           IPETALENVI-----VPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYELSGGEQQRVAIARALANEP
2nq2D           FAYSVLDIVLMGRSTKPKSHDYQVAMQALDYLNLTHLAK-------REFTSLSGGQRQLILIARAIASEC
1v43A           ---TVYENIAFPLKKFPKDEIDKRVRWAAELLQI-------EELLNRYPAQLSGGXXXXXXXXXXXXXEP
3gfoA           FSASVYQDVSFGAVNMKLP---EDEIRKRV--DNALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVMEP
2zu0C           VEIPGVSNQFF------LQTALNAVRSYRGFQDLMEMPE--DLLTRSVNVGFSGGEKKRNDILQMAVLEP
2d3wA           VEIPGVSNQFF------LQTALNAVRSYRGFQDLMEMPE--DLLTRSVNVGFSGGEKKRNDILQMAVLEP
2d3wB           VEIPGVSNQFF------LQTALNAVRSYRGFQDLMEMPE--DLLTRSVNVGFSGGEKKRNDILQMAVLEP
1oxvA           FQTWALENIAFPLTNMKMSKVEEVAKILDIHHVLNHFPR-----------ELSGGQQQRVALARALVKDP
1oxsC           FQTWALENIAFPLTNMKMSKVEEVAKILDIHHVLNHFPR-----------ELSGGQQQRVALARALVKDP
1b0uA           ---------------------------------------------GKYPVHLSGGQQQRVSIARALAMEP
3bk7A           -----YIKAEYEGTVYELLSKIDSSKLSNFYKTELLKPLGIIDLYDRNVEDLSGGELQRVAIAATLLRDA
2d3wD           VEIPGVSNQFF------LQTALNAVRSYRGFQDLMEMPE--DLLTRSVNVGFSGGEKKRNDILQMAVLEP
2d62A           YPHTVYDNIAF-----PLKLKVPKQEIDKRVREVAEL--GLTELLNRKPRELSGGQRQRVALGRAIIRRP
2d2fA           VEVPGVTIANFLRLALQAKGVAEFWTKVKKALELLDWDESYLSRYLNEG--FSGGEKKRNEILQLLVLEP
1vplA           YRNMQIEYLRFASSSSEIEEMVEATEIAGLGEKIKDRVSTY-----------SKGMVRKLLIARALMVNP
2ihyB           -SHSLLEKFQEGERVIDV-VISGAFKSIGVYQDIDDEIRNLLKLVGSAKAQLSTGEKQRV-IARA-LGQP
2d3wC           VEIPGVSNQFF------LQTALNAVRSYRGFQDLMEMPE--DLLTRSVNVGFSGGEKKRNDILQMAVLEP
1f3oA           IPLTALENVE-----LPLGASGEERRKRALECLKAELEERF---ANHKPNQLSGGQQQRVAIARALANNP
1sgwA           PRKISVEDY--------LKAVASLYGVKVNKNEIMDALESVEVLLKKKLGELSQGTIRRVQLASTLLVNA
2d2eA           FQYPVVPGVTIAN-FLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYYLNEGEKKRNEILQLLVLEP
1ji0A           FELTVYENLGAYNRK-------DKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGE-QQLAIGRALSRPK
1z47B           FQMTVYDNVSFG---LREKRVPKDEMDARVRELLRFM--RLESYANRFPHELSGGXXXXXXXXXXXXXXX
1z47A           FQMTVYDNVSFG---LREKRVPKDEMDARVRELLRFM--RLESYANRFPHELSGGXXXXXXXXXXXXXXX
1yqtA           KAD-------YEGTVYELLSKIDASKLSNFYKTELLKPLGIIDLYDREVNELSGGELQRVAIAATLLRDA
2ihyA           -SHSLLEKFQEG------ERVIDVVISGAIDDEIRNEAHQLLKLVGSAKAQLSTGEKQRV-IARA-LGQP
2qi9C           -------TPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLITP
1l7vC           -------TPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLITP
2pjzA           YSTNLPEAYEIGVTVNDIVYLYEELKLDRLFLEMLKALKLGEEILRRKLYKLSAGQSVLVRTSLALASQP
2awnA           -----------------------------------------------------------LAIGRTLVAEP
1oxxK           FQTTAFENIAFPLTNMKMSRVEEVAKILDIHHVLNHFPR-----------ELSGXXXXXXXXXXXXXKDP
2awnD           -----------------------------------------DLFIGEKRMNDTPPAERGVGM-----VEP
2r6fB           -------------------------KIKRKLETLYDVGLGYK--LGQPATTLSGGEAQRVKLAAELHRRS
2r6fA           -------------------------KIKRKLETLYDVGLGYK--LGQPATTLSGGEAQRVKLAAELHRRS
2ix3A           -----------------------------------------DEMIAMPISALSGGWKMKLALARAVLRNA
2iwhB           -----------------------------------------DEMIAMPISALSGGWKMKLALARAVLRNA


                         *         .         .         .         .         +         .:560
query           DILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLILVLQNGQIIERGRHEDLLALD
2hydA           PILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQ
1pf4A           PVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEIIERGRHAD-----
3b60A           PILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQAXXXXXXXXXXXXXRGTHSELLAQH
3g60A           KILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREK
3g5uA           KILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREK
2ghiA           KIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLN
1mt0A           KILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK------
2ff7A           KILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK------
3b5jA           KILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK------
2fgkA           KILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK------
2ffbA           KILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHK------
2ghiC           KIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLN
1xefA           KILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHK------
2ghiB           KIVIFDEATS--DSKTEYLFQKAVEDLRKNRTLIIIAHR--TISSAESIILLNKGKIVEKGTHKDLLKLN
2ffaA           KILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQGKHK------
1z2rA           PILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQAXXXXXXXXXXXXXRGTH-------
2ghiD           KIVIFDDS------KTEYLF---QKAVEDNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLN
1mv5D           KILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATH
1mv5A           KILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATH
2cbzA           DIYLFDDPLSAVDAHVGKHIFENVKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARD
1jj7A           CVLILDDATSALDANSQLQVEQLLYESRYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKK
2ixfA           RLLILDQATSALDAGNQLRVQRLLYESPESRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERG
2ixfC           RLLILDQATSALDAGNQLRVQRLLYESPESRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERG
2ixeA           RLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERG
2ixfD           RLLILDQATSALDAGNQLRVQRLLYESPESRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERG
2ixgA           RLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERG
2ixeD           RLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERG
1r0xB           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0xA           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
2onkA           RLLLLDEPLSAVDLKTKGVLMEELRFVQREPILHVTHDLIEAAMLADEVAVMLNGRIVEKGKLKELFAKN
1q3hD           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1q3hC           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0wB           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0wA           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r10A           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0zD           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0zC           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0zB           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0zA           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0xD           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0xC           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1r0wC           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1q3hB           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1q3hA           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1xf9B           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1xf9A           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1xfaA           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1xf9D           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
1xf9C           DLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSL-
2pzeA           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLD
2pzgA           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
2pzeB           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
1xmiE           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
1xmiA           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
3d31A           KILLLDEPLSALDPRTQ----ENAREMKKNKLTVITHDQTEARIMADRIAVVMDGKLIQVGKPEEI----
1xmiC           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
2pzfA           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLD
2pzfB           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
2bboA           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
1xmiD           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
2yz2B           DILILDEPLVGLDREGKTDLLRIVEKWKTGKTVILISHDIETVIHVDRVVVLEKGKVFDGTRMEFLEKYD
2yz2A           DILILDEPLVGLDREGKTDLLRIVEKWKTGKTVILISHDIETVIHVDRVVVLEKGKVFDGTRMEFLEKYD
1xmjA           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
2it1B           EVLLLDEPLSNLDALLRLEVRAELKRLQKETTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEV----
2it1A           EVLLLDEPLSNLDALLRLEVRAELKRLQKETTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEV----
2pzgB           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
2bbtA           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
2bbsB           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
3dhwC           KVLLCDEATSALDPATTRSILELLKDRRLGLTILLITHEMDVVKRCDCVAVISNGELIEQ----------
2bbtB           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
1xmiB           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
2bbsA           DLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSEL----
2oukB           KIMLFDEPTSALDPEMVGEVLSVMKQANEGMTMVVVTHEMGAREVGDRVLFMDGGYIIEEGKPEDL----
2oljA           KIMLFDEPTSALDPEMVGEVLSVMKQANEGMTMVVVTHEMGAREVGDRVLFMDGGYIIEEGKPEDL----
3fvqB           ELILLDEPFSALDEQLRRQIREDMIAALRGKSAVFVSHREEALQYADRIAVMKQGRILQTASPHEL----
3fvqA           ELILLDEPFSALDEQLRRQIREDMIAALRGKSAVFVSHREEALQYADRIAVMKQGRILQTASPHEL----
1g9xA           KMIVMDEPIAGVAPGLAHDIFNHVLELKKGITFLIIEHRLDIVLYIDHLYVMFNGQIIAEGRGEE-----
1q12A           SVFLLDEPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
3fh6A           SVFLLDEPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
2awoA           SVFLLDEPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
2awnB           SVFLLDEPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
2yyzA           KVLLFDEPLSNLDANLRMIMRAEIKHLQQETSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEV----
1gajA           KMIVMDQPIAGVAPGLAHDIFNHVLELKKGITFLIIEHRLDIVLYIDHLYVMFNGQIIAEGRGEE-----
2r6gB           SVFLLDQPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
2r6gA           SVFLLDQPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
2awoC           SVFLLDEPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
1g6hA           KMIVMDEPIAGVAPGLAHDIFNHVLELKKGITFLIIEHRLDIVLYIDHLYVMFNGQIIAEGRGEE-----
1l2tB           PIILADQPTGALDSKTGEKIMQLLKKLNEEKTVVVVTHDINVARFGERIIYLKDGEV-------------
1l2tA           PIILADQPTGALDSKTGEKIMQLLKKLNEEKTVVVVTHDINVARFGERIIYLKDGEV-------------
2nq2C           KLILLDEPTSALDLANQDIVLSLLIDLAQSQTVVFTTHQPNQVVAIANKTLLLNKQNFKFGETRNIL---
1g291           QVFLMDEPLSNLDAKLRVRMRAELKKLQRQVTTIYVTHQVEAMTMGDRIAVMNRGVLQQVGSPDEV----
2awnC           SVFLLDEPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
2pcjA           ILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVVTHERELAELTHRTLEMKDGKVV------------
2nq2D           KLILLDEPTSALDLANQDIVLSLLIDLAQSQTVVFTTHQPNQVVAIANKTLLLNKQNFKFGETRNIL---
1v43A           DVLLMDEPLSNLDAKLRVAMIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIG---------
3gfoA           KVLILDEPTAGLDPMGVSEIMKLLVEMQKEXXXXXXXXXXXVPLYCDNVFVMKEGRVILQGNPKEVFA--
2zu0C           ELCILDESDSGLDIDALKVVADGVNSLRDGKRSIIVTHRILDYIKPDYVHVLYQGRIVKSG---------
2d3wA           ELCILDESDSGLDIDALKVVADGVNSLRDGKRSIIVTHRILDYIKPDYVHVLYQGRIVKSG---------
2d3wB           ELCILDES-DSLDIDALKVVADGVNSLRDGKRSIVTHYRILDYIKPDYVHVLYQGRIVKSG---------
1oxvA           SLLLLDEPFSNLDARMRDSARALVKESRLGVTLLVVSH--------------------------------
1oxsC           SLLLLDEPFSNLDARMRDSARALVKESRLGVTLLVVSH--------------------------------
1b0uA           DVLLFDEPTSALDPELVGEVLRIMQQLAEEKTMVVVTHEMGFARHSSHVIFLHQGKIEEEGDPEQV----
3bk7A           DIYLLDEPSAYLDVEQRLAVIRHLME-KNEKTALVVEHDVLMIDYVSDRLIVFEG---EPGRH-------
2d3wD           ELCILDES-DGLDIDALKVVADGVNSLRDGKRSIIVTHRILDYIKPDYVHVLYQGRIVKSG---------
2d62A           KV-FLDEPLSNLDAKLRVKRAELKKLQRQGVTTIYVTH--------------------------------
2d2fA           TYAVLDETDSGLDIDALKVVARGVNAMRGPNALVITHYRILNYIQPDKVHVMMDGRVVATGGPELALELE
1vplA           RLAILDEPTSGLDVLNAREVRKILKQASQEGLTIVSSHNMLEVEFCDRIALIHNGTIVETGTVEEL----
2ihyB           QVLILDEPAAGLDAREXXXXXXXXXXXXYPTLAIYVTHFIEEIANFSKILLLKDGQSIQQGAVEDIL---
2d3wC           ELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSG---------
1f3oA           PIILADEPTGALDSKTKIQLLKKLNE-EDGKTVVVVTHDINVARFGERIIYLKDGEV-------------
1sgwA           EIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSR-------------------------------
2d2eA           TYAVLDETDSGLDIDALKVVARGVNAMRGPNALVITHYRILNYIQPDKVHVMMDGRVVATGGPELALELE
1ji0A           ---LLDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQLGALKVAHYGYVLETGQIVLEGKASELL---
1z47B           XXXXFDEPFAAIDTQIRRELRTFVRQVHDETSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKP
1z47A           XXXXFDEPFAAIDTQIRRELRTFVRQVHDETSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKP
1yqtA           DIYLLDEPSAYLDVEQRLAVSRAIRHLEKEKTALVVEH--------------------------------
2ihyA           QVLILDEPAAGLDAREXXXXXXXXXXXXYPTLAIYVTHFIEEIANFSKILLLKDGQSIQQGAVEDIL---
2qi9C           QALLLLDEPNSLDVAQQSALDKILSALSQQGLAIVSSHDLNHTLHAHRAWLLKGGKLAS-GRREEVLTPP
1l7vC           QALLLLDEPNSLDVAQQSALDKILSALCQQGLAIVSSHDLNHTLHAHRAWLLKGGKLAS-GRREEVL---
2pjzA           EIVGLDEPFENVDAARRHVISRYIKEYGKE--GILVTHEL------------------------------
2awnA           SVFLLDEPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
1oxxK           SLLLLDEPFSNLDARMRDSARALVKESRLGVTLLVVSH--------------------------------
2awnD           SVFLLDEPLSNLDARVQMRIEISRLHKRLGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL----
2r6fB           NLYILDEPTTGLHVDDIARLLDVLRLVDNGDTVLVIEHNLDVIKTADYIIDLRGGQIVAVGTPEEVAEVK
2r6fA           NLYILDEPTTGLHVDDIARLLDVLRLVDNGDTVLVIEHNLDVIKTADYIIDLRGGQIVAVGTPEEVAEVK
2ix3A           DILLLDEPTNHLD---------------------------------------------------------
2iwhB           DILLLDEPTNHLD---------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GWYAQTYQSQQLEMKGEExxx
2hydA           GAYEHLYSIQNL---------
1pf4A           ---------------------
3b60A           GVYAQLHKMQ-----------
3g60A           GIYFKLVMTQTLD--------
3g5uA           GIYFKLVMTQTLD--------
2ghiA           GEYAEMWNMQ-----------
1mt0A           ---------------------
2ff7A           ---------------------
3b5jA           ---------------------
2fgkA           ---------------------
2ffbA           ---------------------
2ghiC           GEYAEMWNMQ-----------
1xefA           ---------------------
2ghiB           GEYAEMWNMQ-----------
2ffaA           ---------------------
1z2rA           ---------------------
2ghiD           GEYAEMWNMQ-----------
1mv5D           PLYAK-YVSEQL---------
1mv5A           PLYAK-YVSEQL---------
2cbzA           GAFAETYAS------------
1jj7A           GCY------------------
2ixfA           GCY------------------
2ixfC           GCY------------------
2ixeA           GCY------------------
2ixfD           GCY------------------
2ixgA           GCY------------------
2ixeD           GCY------------------
1r0xB           ---------------------
1r0xA           ---------------------
2onkA           GEVAEFLSARNLLLK------
1q3hD           ---------------------
1q3hC           ---------------------
1r0wB           ---------------------
1r0wA           ---------------------
1r10A           ---------------------
1r0zD           ---------------------
1r0zC           ---------------------
1r0zB           ---------------------
1r0zA           ---------------------
1r0xD           ---------------------
1r0xC           ---------------------
1r0wC           ---------------------
1q3hB           ---------------------
1q3hA           ---------------------
1xf9B           ---------------------
1xf9A           ---------------------
1xfaA           ---------------------
1xf9D           ---------------------
1xf9C           ---------------------
2pzeA           ---------------------
2pzgA           ---------------------
2pzeB           ---------------------
1xmiE           ---------------------
1xmiA           ---------------------
3d31A           ---------------------
1xmiC           ---------------------
2pzfA           ---------------------
2pzfB           ---------------------
2bboA           ---------------------
1xmiD           ---------------------
2yz2B           PRFSKMLVMRRLVLKGED---
2yz2A           PRFSKMLVMRRLVLKGED---
1xmjA           ---------------------
2it1B           ---------------------
2it1A           ---------------------
2pzgB           ---------------------
2bbtA           ---------------------
2bbsB           ---------------------
3dhwC           ---------------------
2bbtB           ---------------------
1xmiB           ---------------------
2bbsA           ---------------------
2oukB           ---------------------
2oljA           ---------------------
3fvqB           ---------------------
3fvqA           ---------------------
1g9xA           ---------------------
1q12A           ---------------------
3fh6A           ---------------------
2awoA           ---------------------
2awnB           ---------------------
2yyzA           ---------------------
1gajA           ---------------------
2r6gB           ---------------------
2r6gA           ---------------------
2awoC           ---------------------
1g6hA           ---------------------
1l2tB           ---------------------
1l2tA           ---------------------
2nq2C           ---------------------
1g291           ---------------------
2awnC           ---------------------
2pcjA           ---------------------
2nq2D           ---------------------
1v43A           ---------------------
3gfoA           ---------------------
2zu0C           ---------------------
2d3wA           ---------------------
2d3wB           ---------------------
1oxvA           ---------------------
1oxsC           ---------------------
1b0uA           ---------------------
3bk7A           ---------------------
2d3wD           ---------------------
2d62A           ---------------------
2d2fA           ---------------------
1vplA           ---KERYKAQNIEEVFEE---
2ihyB           ---------------------
2d3wC           ---------------------
1f3oA           ---------------------
1sgwA           ---------------------
2d2eA           ---------------------
1ji0A           ---------------------
1z47B           G--------------------
1z47A           G--------------------
1yqtA           ---------------------
2ihyA           ---------------------
2qi9C           N-LAQAYGNRRLDIEG-----
1l7vC           ---------------------
2pjzA           ---------------------
2awnA           ---------------------
1oxxK           ---------------------
2awnD           ---------------------
2r6fB           ESHTGRYLKPILE--------
2r6fA           ESHTGRYLKPILE--------
2ix3A           ---------------------
2iwhB           ---------------------