[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:prfC

[Show Plain Result]

#ERROR : Can't open dsspfile "2h5eA.bssp"
#ERROR : Can't open dsspfile "2h5eB.bssp"
#ERROR : Can't open dsspfile "2bm0A.bssp"
#ERROR : Can't open dsspfile "2bm1A.bssp"
#ERROR : Can't open dsspfile "2j7kA.bssp"
#ERROR : Can't open dsspfile "2om7L.bssp"
#ERROR : Can't open dsspfile "1fnmA.bssp"
#ERROR : Can't open dsspfile "2bv3A.bssp"
#ERROR : Can't open dsspfile "1eloA.bssp"
#ERROR : Can't open dsspfile "1darA.bssp"
#ERROR : Can't open dsspfile "2efgA.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "2dy1A.bssp"
#ERROR : Can't open dsspfile "2ywfA.bssp"
#ERROR : Can't open dsspfile "2ywgA.bssp"
#ERROR : Can't open dsspfile "2ywhA.bssp"
#ERROR : Can't open dsspfile "1zm4A.bssp"
#ERROR : Can't open dsspfile "1u2rA.bssp"
#ERROR : Can't open dsspfile "2p8xT.bssp"
#ERROR : Can't open dsspfile "2p8wT.bssp"
#ERROR : Can't open dsspfile "2npfA.bssp"
#ERROR : Can't open dsspfile "1n0uA.bssp"
#ERROR : Can't open dsspfile "1n0vC.bssp"
#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "2e1rA.bssp"
#ERROR : Can't open dsspfile "2yweA.bssp"
#ERROR : Can't open dsspfile "1ijeA.bssp"
#ERROR : Can't open dsspfile "1g7cA.bssp"
#ERROR : Can't open dsspfile "1f60A.bssp"
#ERROR : Can't open dsspfile "2b7cA.bssp"
#ERROR : Can't open dsspfile "1wb1C.bssp"
#ERROR : Can't open dsspfile "1tuiA.bssp"
#ERROR : Can't open dsspfile "1ob5A.bssp"
#ERROR : Can't open dsspfile "1eftA.bssp"
#ERROR : Can't open dsspfile "1b23P.bssp"
#ERROR : Can't open dsspfile "1wb3B.bssp"
#ERROR : Can't open dsspfile "2npfB.bssp"
#ERROR : Can't open dsspfile "1exmA.bssp"
#ERROR : Can't open dsspfile "2c78A.bssp"
#ERROR : Can't open dsspfile "2c77A.bssp"
#ERROR : Can't open dsspfile "1wb1B.bssp"
#ERROR : Can't open dsspfile "1mj1A.bssp"
#ERROR : Can't open dsspfile "1wb2A.bssp"
#ERROR : Can't open dsspfile "1wb1A.bssp"
#ERROR : Can't open dsspfile "1ob2A.bssp"
#ERROR : Can't open dsspfile "2fx3A.bssp"
#ERROR : Can't open dsspfile "3fihZ.bssp"
#ERROR : Can't open dsspfile "1efcA.bssp"
#ERROR : Can't open dsspfile "1dg1G.bssp"
#ERROR : Can't open dsspfile "1d8tB.bssp"
#ERROR : Can't open dsspfile "1d8tA.bssp"
#ERROR : Can't open dsspfile "2bvnA.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "3cb4D.bssp"

## Summary of PDB Search
:514
    e-110  47%  2h5eA  [x.x.x] PEPTIDE CHAIN RELEASE FACTOR RF-3
    e-102  46%  2h5eB  [x.x.x] PEPTIDE CHAIN RELEASE FACTOR RF-3
    2e-38  29%  2bm0A  [x.x.x] ELONGATION FACTOR G
    3e-37  29%  2bm1A  [x.x.x] ELONGATION FACTOR G
    1e-36  28%  2j7kA  [x.x.x] ELONGATION FACTOR G
    1e-35  30%  2om7L  [x.x.x] ELONGATION FACTOR G
    1e-35  30%  1fnmA  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    3e-33  31%  2bv3A  [x.x.x] ELONGATION FACTOR G
    3e-30  31%  1eloA  [c.37.1 - b.43.3 - d.14.1 - d.58.11 (1ktvA)] ELONGATION
    4e-30  31%  1darA  [x.x.x] ELONGATION FACTOR G
    9e-30  31%  2efgA  [c.37.1 - b.43.3 - d.14.1 - d.58.11] PROTEIN (ELONGATION
    1e-17  32%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
    4e-13  30%  2dy1A  [x.x.x] ELONGATION FACTOR G
    2e-12  32%  2ywfA  [x.x.x] GTP-BINDING PROTEIN LEPA
    4e-12  29%  2ywgA  [x.x.x] GTP-BINDING PROTEIN LEPA
    1e-11  32%  2ywhA  [x.x.x] GTP-BINDING PROTEIN LEPA
    2e-10  24%  1zm4A  [x.x.x] ELONGATION FACTOR 2
    2e-10  24%  1u2rA  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    2e-10  24%  2p8xT  [x.x.x] ELONGATION FACTOR 2
    2e-10  24%  2p8wT  [x.x.x] ELONGATION FACTOR 2
    2e-10  24%  2npfA  [x.x.x] ELONGATION FACTOR 2
    2e-10  24%  1n0uA  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    3e-10  25%  1n0vC  [c.37.1 - b.43.3 - d.58.11 - d.14.1 - d.58.11] ELONGATION
    5e-10  32%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    6e-10  25%  2e1rA  [x.x.x] ELONGATION FACTOR 2
    1e-09  32%  2yweA  [x.x.x] GTP-BINDING PROTEIN LEPA
    9e-08  34%  1ijeA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    9e-08  34%  1g7cA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR 1-ALPHA
    9e-08  34%  1f60A  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR EEF1A
    9e-08  34%  2b7cA  [x.x.x] ELONGATION FACTOR 1-ALPHA
    5e-07  23%  1wb1C  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    2e-06  25%  1tuiA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-06  25%  1ob5A  [x.x.x] ELONGATION FACTOR TU
    2e-06  25%  1eftA  [x.x.x] ELONGATION FACTOR TU
    2e-06  25%  1b23P  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-06  25%  1wb3B  [c.37.1 - b.43.3 - b.44.1] TRANSLATION ELONGATION FACTOR SELB
    3e-06  24%  2npfB  [x.x.x] ELONGATION FACTOR 2
    3e-06  25%  1exmA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU (EF-TU)
    3e-06  25%  2c78A  [x.x.x] ELONGATION FACTOR TU-A
    3e-06  25%  2c77A  [x.x.x] ELONGATION FACTOR TU-B
    5e-06  25%  1wb1B  [c.37.1 - b.43.3 - b.44.1] TRANSLATION ELONGATION FACTOR SELB
    3e-04  25%  1mj1A  [i.1.1] ELONGATION FACTOR TU
    4e-04  21%  1wb2A  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    6e-04  20%  1wb1A  [c.37.1 - b.43.3 - b.44.1 - b.43.3] TRANSLATION ELONGATION
    6e-04  24%  1ob2A  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    6e-04  24%  2fx3A  [x.x.x] ELONGATION FACTOR TU
    6e-04  24%  3fihZ  [x.x.x] ELONGATION FACTOR TU
    6e-04  24%  1efcA  [c.37.1 - b.43.3 - b.44.1] PROTEIN (ELONGATION FACTOR)
    6e-04  24%  1dg1G  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    6e-04  24%  1d8tB  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    6e-04  24%  1d8tA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    8e-04  25%  2bvnA  [x.x.x] ELONGATION FACTOR TU
    5e-04  23%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA(query 232->452)
    5e-04  23%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA(query 232->452)
:514

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIEKQRGISVTSS
2h5eA           ----QEVAKRRTFAIISHPDAGKTTITEKVLLFG-------------------------------QITTS
2h5eB           ----QEVAKRRTFAIISHPDAGKTTITEKVLLFGQ--------------------------------TTS
2bm0A           --VEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIATITAAVTTCF----WKD------------
2bm1A           --VEYDLKRLRNIVIAAHIDAGKTTTTERILYYTGRI-----------------------------ITAA
2j7kA           --VEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIH----------------------------ITAA
2om7L           -----DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIAV--------TTCF----WKD------------
1fnmA           -----DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIAV--------TTCF----WKD------------
2bv3A           -----DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHK-----------------------RGITITAA
1eloA           --VEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIAV--------TTCF----WKD------------
1darA           VKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTG--------RAAVTTCF----WKD------------
2efgA           -----DLKRLRNIGIAAHIDAGKTTTTERILYYTGRIAAVTTCF-----------WKD------------
3degC           ------MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSD-------REMEAQVLDSMDLERERGITIKAQ
2dy1A           ----------RTVALVGHAGSGKTTLTEALLYKTG----AKXXXXXXXXXXXXXDYTPEAKLHRTTVRTG
2ywfA           -----EQKNVRNFCIIAHVDHGKSTLADRLLEYTGAI--------------------------GITVKMQ
2ywgA           -----EQKNVRNFCIIAHVDHGKSTLADRLLEYTGAVKQAVRFYKAKDGNTYK-----------------
2ywhA           -----EQKNVRNFCIIAHVDHGKSTLADRLLEY------TGAVKMQAVRMFYKAK---------------
1zm4A           -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAGITIKSTAISLYSEMSDEDVKEIK-------
1u2rA           -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAGITIKSTAISLYSEMSDEDVKEIK-------
2p8xT           -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAGITIKSTAISLYSEMSDEDVKEIK-------
2p8wT           -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAGITIKSTAISLYSEMSDEDVKEIK-------
2npfA           -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAGITIKSTAISLYSEMSDEDVKEIK-------
1n0uA           -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAGITIKSTAISLYSEMSDEDVKEIK-------
1n0vC           -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAAKGITIKSTAISLYSEMSDED------VKEI
3cb4D           ---------------------------------------------------------------GQSVTLD
2e1rA           -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAA-----KERGITIKSTAISLYSEMSDEDVKE
2yweA           -----EQKNVRNFCIIAHH--GKSTLADRLLEY------TGAVKMQAVRMFYKAK---------------
1ijeA           -------KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEGSFKYADKLKAERERGITIDIA
1g7cA           -------KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEGSFKYADKLKAERERGITIDIA
1f60A           -------KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEGSFKYADKLKAERERGITIDIA
2b7cA           -------KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEGSFKYADKLKAERERGITIDIA
1wb1C           --------KNINLGIFGHIDHGKTTLSKVLT---------------EIASTSAHDKLPESQKRGITIDIG
1tuiA           -----------------------------------------------------------ERARGITINTA
1ob5A           -----------------------------------------------------------ERARGITINTA
1eftA           -----------------------------------------------------------ERARGITINTA
1b23P           -----------------------------------------------------------ERARGITINTA
1wb3B           --------KNINLGIFGHIDHGKTTLSKVLTEIAPE-----------------------SQKRGITIDIG
2npfB           -SLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAGITIKSTAISLYSEMSDEDVKEIK-------
1exmA           -----------------------------------------------------------ERARGITINTA
2c78A           -----------------------------------------------------------ERARGITINTA
2c77A           -----------------------------------------------------------ERARGITINTA
1wb1B           --------KNINLGIFGHIDHGKTTLSKVLT-------EIASPESQK---------------RGITIDIG
1mj1A           -----------------------------------------------------------ERARGITINTA
1wb2A           ------------------------------------------------------------------IASG
1wb1A           -------------------------------------------KNINLGIFGHIDHGKTTLSKVLTEIAG
1ob2A           --------------------------------------------GGAARAFDQIDNAPEEKARGITINTS
2fx3A           --------------------------------------------GGAARAFDQIDNAPEEKARGITINTS
3fihZ           --------------------------------------------GGAARAFDQIDNAPEEKARGITINTS
1efcA           --------------------------------------------GGAARAFDQIDNAPEEKARGITINTS
1dg1G           --------------------------------------------GGAARAFDQIDNAPEEKARGITINTS
1d8tB           --------------------------------------------GGAARAFDQIDNAPEEKARGITINTS
1d8tA           --------------------------------------------GGAARAFDQIDNAPEEKARGITINTS
2bvnA           -----------------------------------------------------------EKARGITINTS
3degC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VMQFDYDGKRVNXLDTPGHEDFSEDTYRTLXXXXXXXXXXXXXKGIEAQTXKLFEVVKHRGIPVFTFMNK
2h5eA           VMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNK
2h5eB           VMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNK
2bm0A           --------HRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
2bm1A           VTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
2j7kA           VTTCFWKDHRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
2om7L           --------HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
1fnmA           --------HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
2bv3A           VTTCFWKDHRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
1eloA           --------HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
1darA           --------HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
2efgA           --------HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANK
3degC           SVTLDYDGEQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNK
2dy1A           VAPLLFRGHRVFLLDAPGYGDFVGEIRGXXXXXXXXXXXXXXXXGVQVGTERAWTVAERLGLPRMVVVTK
2ywfA           AVRMFYKAKKLHLIDTPGHVDFSYEVSRALAACEGALLLIDASQGIEAQTVANFWKAVEQDLVIIPVINK
2ywgA           ----------LHLIDTPGHVDFSYEVSRALAACEGALLLIDASQGIEAQTVANFWKAVEQDLVIIPVINK
2ywhA           ----DGNTYKLHLIDTPGHVDFSYEVSRALAACEGALLLIDASQGIEAQTVANFWKAVEQDLVIIPVINK
1zm4A           -QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
1u2rA           -QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
2p8xT           -QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
2p8wT           -QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
2npfA           -QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
1n0uA           -QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
1n0vC           KQKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
3cb4D           YKASDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNK
2e1rA           IKQTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
2yweA           ----DGNTYKLHLIDTPGHVDFSYEVSRALAACEGALLLIDASQGIEAQTVANFWKAVEQDLVIIPVINK
1ijeA           LWKFETPKYQVTVIDAPGHRDF------------------------------------------------
1g7cA           LWKFETPKYQVTVIDAPGHRDF------------------------------------------------
1f60A           LWKFETPKYQVTVIDAPGHRDF------------------------------------------------
2b7cA           LWKFETPKYQVTVIDAPGHRDF------------------------------------------------
1wb1C           FSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITK
1tuiA           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
1ob5A           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
1eftA           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
1b23P           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
1wb3B           FSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITK
2npfB           -QKTDGNSFLINLID-----DFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINK
1exmA           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
2c78A           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
2c77A           HVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNK
1wb1B           FSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITK
1mj1A           HVEYETAKRHYSHVDCRGHADYIKNMITGAAQMDGAILVVSAADGRMRQTREHILLARQVGVRIVVFMNK
1wb2A           FSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITK
1wb1A           FSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITK
1ob2A           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
2fx3A           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
3fihZ           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
1efcA           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
1dg1G           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
1d8tB           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
1d8tA           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
2bvnA           HVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFLNK
3degC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDRDGREPLDLLQELEEILGIASYPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNP
2h5eA           LDRDIRDPMELLDEVENELKIGCAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEDLDAAVGED-
2h5eB           LDRDIRDPMELLDEVENELKIGCAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEDLDAAVGED-
2bm0A           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLG----TDIREIPIPEE
2bm1A           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLG----TDIREIPIPEE
2j7kA           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLG----TDIREIPIPEE
2om7L           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLG----TDIREIPIPEE
1fnmA           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLG----TDIREIPIPEE
2bv3A           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLG----TDIREIPIPEE
1eloA           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLG----TDIREIPIPEE
1darA           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLG----TDIREIPIPEE
2efgA           MDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLG----TDIREIPIPEE
3degC           IDLPAADPERVAEEIEDIVGI-------------------------------------------------
2dy1A           LDKGG-DYYALLEDLRSTLG-PILPIDLPLYEGGKWVGLIDVFHGKAYRYENGXXXXXXXXXXXXXXXXX
2ywfA           IDLPSADVDRVKKQIEEVLGL-------------------------------------------------
2ywgA           IDLPSADVDRVKKQIEEVLGL-------------------------------------------------
2ywhA           IDLPSADVDRVKKQIEEVLGL-------------------------------------------------
1zm4A           VDRALLEKEDLYQTFDEVLGVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
1u2rA           VDRALLEKEDLYQTFDEVLGVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
2p8xT           VDRALLEKEDLYQTFDEVLGVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
2p8wT           VDRALLEKEDLYQTFDEVLGVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
2npfA           VDRALLEKEDLYQTFDEVLGVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
1n0uA           VDRALLEKEDLYQTFDEVLGVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
1n0vC           VDRALLEKEDLYQTFDEVLGVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
3cb4D           IDLPAADPERVAEEIEDIVGI-------------------------------------------------
2e1rA           VDRALLEKEDLYQTFDEVLGVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
2yweA           IDLPSADVDRVKKQIEEVLGL-------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1wb1C           SDNAGTEEISILQSTHNLKNSSIIPISAKTGFG-------------------------------------
1tuiA           VDMDDPELLDLVEEVRDLLNQYEFPGDVPVIRGSALLALEEMH---------------------------
1ob5A           VDMDDPELLDLVEEVRDLLNQYEFPGDVPVIRGSALLALEEMH---------------------------
1eftA           VDMDDPELLDLVEEVRDLLNQYEFPGDVPVIRGSALLALEEMH---------------------------
1b23P           VDMDDPELLDLVEEVRDLLNQYEFPGDVPVIRGSALLALEEMH---------------------------
1wb3B           SDNAGTEEISILQSTHNLKNSSIIPISAKTGFG-------------------------------------
2npfB           VDRALLEKEDLYQTFDEVLGVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSF
1exmA           VDMDDPELLDLVEEVRDLLNQYEFPGDVPVIRGSALLALEQMH---------------------------
2c78A           VDMDDPELLDLVEEVRDLLNQYEFPGDVPVIRGSALLALEQMH---------------------------
2c77A           VDMDDPELLDLVEEVRDLLNQYEFPGDVPVIRGSALLALEQMH---------------------------
1wb1B           SDNAGTEEISILQSTHNLKNSSIIPISAKTGFG-------------------------------------
1mj1A           VDMDDRELLDLVEEVRDLL---------------------------------------------------
1wb2A           SDNAGTEEISILQSTHNLKNSSIIPISAKTGFG-------------------------------------
1wb1A           SDNAGTEEISILQSTHNLKNSSIIPISAKTGFG-------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FYEQVKDDIELLNEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGEIVDP
2h5eA           LAQQLRDELELVKGASNEFDKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPM-PRQTDTRTVEA
2h5eB           LAQQLRDELELVKGASNEFDKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPM-PRQTDTRTVEA
2bm0A           YLDQAREYHEKLVEVAADFDENIMLKYKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDGTTPEGEVVEI
2bm1A           YLDQAREYHEKLVEVAADFDENIMLKYKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDGTTPEGEVVEI
2j7kA           YLDQAREYHEKLVEVAADFDENIMLKYKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDGTTPEGEVVEI
2om7L           YLDQAREYHEKLVEVAADFDENIMLKYKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDGTTPEGEVVEI
1fnmA           YLDQAREYHEKLVEVAADFDENIMLKYKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDGTTPEGEVVEI
2bv3A           YLDQAREYHEKLVEVAADFDENIMLKYKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDGTTPEGEVVEI
1eloA           YLDQAREYHEKLVEVAADFDENIMLKYKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDGTTPEGEVVEI
1darA           YLDQAREYHEKLVEVAADFDENIMLKYKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDGTTPEGEVVEI
2efgA           YLDNAREYHEKLVEVAADFDENIMLKYKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDGTTPEGEVVEI
3degC           ----------------------------------------------------------------------
2dy1A           XXXXXXXAIXVTGEALEKAFHEAVRRGLLYPVALASGEREIGVXXXXXXXXXXXXSP-TERFGDG---PP
2ywfA           ----------------------------------------------------------------------
2ywgA           ----------------------------------------------------------------------
2ywhA           ----------------------------------------------------------------------
1zm4A           FNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFLFTAIMNF-----------------------------
1u2rA           FNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFLFTAIMNF-----------------------------
2p8xT           FNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFLFTAIMNF-----------------------------
2p8wT           FNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFLFTAIMNF-----------------------------
2npfA           FNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFLFTAIMNF-----------------------------
1n0uA           FNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFLFTAIMNF-----------------------------
1n0vC           FNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFLFTAIMNF-----------------------------
3cb4D           ----------------------------------------------------------------------
2e1rA           FNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFLFTAIMNF-----------------------------
2yweA           ----------------------------------------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1wb1C           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
2npfB           FNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFLFTAIMNF-----------------------------
1exmA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1wb1B           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
3degC           ---------------------EDIVGIDATDAVRCSAKTGVGVQDVLERLVRXXXXXXXXXXXXLQIIDS
3cb4D           ---------------------EDIVGIDATDAVRCSAKTGVGVQDVLERLVRXXXXXXXXXXXXLQIIDS


                         .         *         .         .         .         .         +:350
query           YDKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAESRENVINAVA
2h5eA           SEDKFTGFVFKIQANMDPKHRDRVAFMRVVSGKYEKGMKLRQVRTAKDVVISDALTFMA-----VEEAYP
2h5eB           SEDKFTGFVFKIQA--------RVAFMRVVSGKYEKGMKLRQVRTAKDVVISDALTFMA-----VEEAYP
2bm0A           HNGPLAALAFKIMA--DP-YVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
2bm1A           HNGPLAALAFKIMA--DP-YVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
2j7kA           HNGPLAALAFKIMA--DP-YVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
2om7L           HNGPLAALAFKIMA--DP-YVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
1fnmA           HNGPLAALAFKIMA--DP-YVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
2bv3A           HNGPLAALAFKIMA--DP-YVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
1eloA           HNGPLAALAFKIMA--DP-YVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
1darA           HNGPLAALAFKIMA--DP-YVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
2efgA           HNGPLAALAFKIMA--DP-YVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKA
3degC           ----------------------------------------------------------------------
2dy1A           LAK-----VFKVQ--VDP-FMGQVAYLRLYRGRLKPGDS--LQSEAGQVRLPHLYVPMGKDLLEVEEAEA
2ywfA           ----------------DP-YRGAVAFVRIFDGEVKPGDKIMLMSTGKGAQTPKMTKFDKLSAGDV-GYIA
2ywgA           ----------------DP-YRGAVAFVRIFDGEVKPGDKI--LSTGKEYEVTEVGAQTPKTKFDKLS--A
2ywhA           ----------------DP-YRGAVAFVRIFDGEVKPGDKIMLMSTGKGAQTPKMTKFDKLSAGDV-GYIA
1zm4A           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
2yweA           ----------------DP-YRGAVAFVRIFDGEVKPGDKIMLMSTGKGAQTPKMTKFDKLSAGDV-GYIA
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1wb1C           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
2npfB           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1wb1B           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
3degC           WFDNYLGVV---------------SLIRIKNGTLRKGDKVKVMSTGQADRLGIFTPKQVDRTELKCGEVG
3cb4D           WFDNYLGVV---------------SLIRIKNGTLRKGDKVKVMSTGQADRLGIFTPKQVDRTELKCGEVG


                         .         .         .         .         *         .         .:420
query           GDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQKSFHKGIEQLVQEGAIQLYKN
2h5eA           GDILGLHNHGTIQIGDTFTQGE-MMKFTGIPNFAPELFRRIRLKD---PKQLLKGLVQLSEEGAVQVFRP
2h5eB           GDILGLHNHGTIQIGDTFTQGE-MMKFTGIPNFAPELFRRIR----LKDKQLLKGLVQLSEEGAVQVFRP
2bm0A           GDLGAVVGLKETITGDTL-VGEDRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDTFRVSTH
2bm1A           GDLGAVVGLKETITGDTL-VGEDRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDTFRVSTH
2j7kA           GDLGAVVGLKETITGDTL-VGEDRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDTFRVSTH
2om7L           GDLGAVVGLKETITGDTL-VGEDRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDTFRVSTH
1fnmA           GDLGAVVGLKETITGDTL-VGEDRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDTFRVSTH
2bv3A           GDLGAVVGLKETITGDTL----------------------------------------------------
1eloA           GDLGAVVGLKETITGDTL----------------------------------------------------
1darA           GDLGAVVGLKETITGDTL----------------------------------------------------
2efgA           GDLGAVVGLKETITGDTL----------------------------------------------------
3degC           ----------------------------------------------------------------------
2dy1A           GFVLGVPKAEGLHRGMVLWQGE-KPESEEVP---------------------------------------
2ywfA           ASIKDVRD---IRIGDTITHAKNPTK-EPVPGFQPAVYAGIYPAEDTTYEELRDALEKYAINDAAIVYEP
2ywgA           GDVASIKDVRDIRIGDTITHAKNPTK-EPVPGFQPPVYAGIYPAEDTTYEELRDALEKYAINDAAIVYES
2ywhA           ASIKDVRD---IRIGDTITHAKNPTK-EPVPGFQPAVYAGIYPAEDTTYEELRDALEKYAINDAAIVYEP
1zm4A           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
2yweA           ASIKDVRD---IRIGDTITHAKNPTK-EPVPGFQPAVYAGIYPAEDTTYEELRDALEKYAINDAAIVYEP
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1wb1C           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
2npfB           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1wb1B           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
3degC           WLVCAIKDIHGAPVGDTLTLARNPAE-KALPGFKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEP
3cb4D           WLVCAIKDIHGAPVGDTLTLARNPAE-KALPGFKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEP


                         .         .         +         .         .         .         .:490
query           YQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPMGKKTVRWIKPEDLDERMSSSRNXLAKDRFDQPVF
2h5eA           ISNNDLIVGAVGVLQFDVVVARLKSEYNVEAVYESVNVATARWVECADFEEFKRKNESQLALDGGDNLAY
2h5eB           ISNNDLIVGAVGVLQFDVVVARLKSEYNVEAVYESVNVATARWVECADFEEFKRKNESQLALDGGDNLAY
2bm0A           PETGQTIISGMGELHLEIIVDRLKREFKVDA---NVGKPQVAYTKPVDVE--------------------
2bm1A           PETGQTIISGMGELHLEIIVDRLKREFKVDA---NVGKPQVAYTKPVDVE--------------------
2j7kA           PETGQTIISGMGELHLEIIVDRLKREFKVDA---NVGKPQVAYTKPVDVE--------------------
2om7L           PETGQTIISGMGELHLEIIVDRLKREFKVDA---NVGKPQVAYTKPVDVE--------------------
1fnmA           PETGQTIISGMGELHLEIIVDRLKREFKVDA---NVGKPQVAYTKPVDVE--------------------
2bv3A           ----------------------------------------------------------------------
1eloA           ----------------------------------------------------------------------
1darA           ----------------------------------------------------------------------
2efgA           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
2ywfA           ESSPAFRVGFLGLLHMEIVQERLEREYGVKII--------------------------------------
2ywgA           SPAXXXXXXXXXXXXHEIVQERLEREYGVKII--------------------------------------
2ywhA           ESSPAFRVGFLGLLHMEIVQERLEREYGVKII--------------------------------------
1zm4A           ----------------------------------------------------------------------
1u2rA           ----------------------------------------------------------------------
2p8xT           ----------------------------------------------------------------------
2p8wT           ----------------------------------------------------------------------
2npfA           ----------------------------------------------------------------------
1n0uA           ----------------------------------------------------------------------
1n0vC           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
2yweA           ESSPAFRVGFLGLLHMEIVQERLEREYGVKII--------------------------------------
1ijeA           ----------------------------------------------------------------------
1g7cA           ----------------------------------------------------------------------
1f60A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1wb1C           ----------------------------------------------------------------------
1tuiA           ----------------------------------------------------------------------
1ob5A           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1wb3B           ----------------------------------------------------------------------
2npfB           ----------------------------------------------------------------------
1exmA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
1wb1B           ----------------------------------------------------------------------
1mj1A           ----------------------------------------------------------------------
1wb2A           ----------------------------------------------------------------------
1wb1A           ----------------------------------------------------------------------
1ob2A           ----------------------------------------------------------------------
2fx3A           ----------------------------------------------------------------------
3fihZ           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
3degC           ESSSXXXXXXXXXXHMEIIQERLEREYDLDLI--------------------------------------
3cb4D           ESSSXXXXXXXXXXHMEIIQERLEREYDLDLI--------------------------------------


                         *         .         .         .         .         +         .:560
query           LFENDFALRWFADKYPDVELEExx
2h5eA           IATSMVNLRLAQERYPDVQFHQ--
2h5eB           IATSMVNLRLAQERYPDVQFHQ--
2bm0A           ------------------------
2bm1A           ------------------------
2j7kA           ------------------------
2om7L           ------------------------
1fnmA           ------------------------
2bv3A           ------------------------
1eloA           ------------------------
1darA           ------------------------
2efgA           ------------------------
3degC           ------------------------
2dy1A           ------------------------
2ywfA           ------------------------
2ywgA           ------------------------
2ywhA           ------------------------
1zm4A           ------------------------
1u2rA           ------------------------
2p8xT           ------------------------
2p8wT           ------------------------
2npfA           ------------------------
1n0uA           ------------------------
1n0vC           ------------------------
3cb4D           ------------------------
2e1rA           ------------------------
2yweA           ------------------------
1ijeA           ------------------------
1g7cA           ------------------------
1f60A           ------------------------
2b7cA           ------------------------
1wb1C           ------------------------
1tuiA           ------------------------
1ob5A           ------------------------
1eftA           ------------------------
1b23P           ------------------------
1wb3B           ------------------------
2npfB           ------------------------
1exmA           ------------------------
2c78A           ------------------------
2c77A           ------------------------
1wb1B           ------------------------
1mj1A           ------------------------
1wb2A           ------------------------
1wb1A           ------------------------
1ob2A           ------------------------
2fx3A           ------------------------
3fihZ           ------------------------
1efcA           ------------------------
1dg1G           ------------------------
1d8tB           ------------------------
1d8tA           ------------------------
2bvnA           ------------------------
3degC           ------------------------
3cb4D           ------------------------