[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56337.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vimC.bssp"
#ERROR : Can't open dsspfile "1vimB.bssp"
#ERROR : Can't open dsspfile "1vimA.bssp"
#ERROR : Can't open dsspfile "1yvrA.bssp"
#ERROR : Can't open dsspfile "1yvpB.bssp"
#ERROR : Can't open dsspfile "1yvpA.bssp"
#ERROR : Can't open dsspfile "2i91B.bssp"

## Summary of PDB Search
:269
    1e-04  33%  1vimC  [c.80.1] HYPOTHETICAL PROTEIN AF1796
    1e-04  33%  1vimB  [c.80.1] HYPOTHETICAL PROTEIN AF1796
    1e-04  33%  1vimA  [c.80.1] HYPOTHETICAL PROTEIN AF1796
    6e-04  31%  1yvrA  [x.x.x] 60-KDA SS-A/RO RIBONUCLEOPROTEIN
    6e-04  31%  1yvpB  [x.x.x] 60-KDA SS-A/RO RIBONUCLEOPROTEIN
    6e-04  31%  1yvpA  [x.x.x] 60-KDA SS-A/RO RIBONUCLEOPROTEIN
    6e-04  31%  2i91B  [x.x.x] 60 KDA SS-A/RO RIBONUCLEOPROTEIN
:269

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxDIAKFFLKQQPLNDYSSKALCEYLNVSKATLTRFAKKCGFKGFRQFI
1vimC           ----------------------------------------------------------------------
1vimB           ----------------------------------------------------------------------
1vimA           ----------------------------------------------------------------------
1yvrA           -----------------------NLAMAVTKYKQRNGWSHKDLLRLSHIKPANLTMVAKYVS-KGWKQEA
1yvpB           -----------------------NLAMAVTKYKQRNGWSHKDLLRLSHIKPANLTMVAKYVS-KGWKQEA
1yvpA           -----------------------NLAMAVTKYKQRNGWSHKDLLRLSHIKPANLTMVAKYVS-KGWKQEA
2i91B           -----------------------NLAMAVTKYKQRNGWSHKDLLRLSHIKPANLTMVAKYVS-KGWKQEA


                         .         .         *         .         .         .         .:140
query           FKYQEMIHEKEKLALYTEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYGKGSSVLALQE
1vimC           ---------------------EVVSEHIKNLR------NHIDLETVGEMIDSARSIFVIGAGRSGYIAKA
1vimB           ---------------------EVVSEHIKNLR------NHIDLETVGEMIDSARSIFVIGAGRSGYIAKA
1vimA           ---------------------EVVSEHIKNLR------NHIDLETVGEMIDSARSIFVIGAGRSGYIAKA
1yvrA           YKEKELSPETEKVLKYLEATERVKRTKDEL--EIIHLIDEYRLVR-----EHLLTIHLKSKEIWKSLLQD
1yvpB           YKEKELSPETEKVLKYLEATERVKRTKDEL--EIIHLIDEYRLVR-----EHLLTIHLKSKEIWKSLLQD
1yvpA           YKEKELSPETEKVLKYLEATERVKRTKDEL--EIIHLIDEYRLVR-----EHLLTIHLKSKEIWKSLLQD
2i91B           YKEKELSPETEKVLKYLEATERVKRTKDEL--EIIHLIDEYRLVR-----EHLLTIHLKSKEIWKSLLQD


                         +         .         .         .         .         *         .:210
query           MKMRFMRLGVIGEVLSDEDMILWSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTTRKxxx
1vimC           FAMRLMHLXXXXXXITDQDVL-------------VGISGSGETTSVVNISKKAKDIGSKLVAVTGKR---
1vimB           FAMRLMHLXXXXXXITDQDVL-------------VGISGSGETTSVVNISKKAKDIGSKLVAVTGKR---
1vimA           FAMRLMHLXXXXXXITDQDVL-------------VGISGSGETTSVVNISKKAKDIGSKLVAVTGKR---
1yvrA           MPLTAL-LRNLGKMTAD-----------------------------------------------------
1yvpB           MPLTAL-LRNLGKMTAD-----------------------------------------------------
1yvpA           MPLTAL-LRNLGKMTAD-----------------------------------------------------
2i91B           MPLTAL-LRNLGKMTAD-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vimC           -----------------------------------------------------------
1vimB           -----------------------------------------------------------
1vimA           -----------------------------------------------------------
1yvrA           -----------------------------------------------------------
1yvpB           -----------------------------------------------------------
1yvpA           -----------------------------------------------------------
2i91B           -----------------------------------------------------------