[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56378.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "1xewY.bssp"
#ERROR : Can't open dsspfile "1xexB.bssp"

## Summary of PDB Search
:210
    4e-30  37%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-30  37%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-28  32%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    1e-27  38%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    3e-26  34%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    8e-25  32%  2oukB  [x.x.x] PROTEIN ARTP
    8e-25  32%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    1e-24  38%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-23  33%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    6e-22  31%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    6e-22  31%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-21  31%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    2e-21  31%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-21  31%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-21  31%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-21  30%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-21  30%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-21  30%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-20  34%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-20  34%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-20  29%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    2e-20  30%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-20  35%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    6e-20  34%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    8e-20  28%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    1e-19  33%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    2e-18  27%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-18  27%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    5e-18  30%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    9e-18  29%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    9e-18  29%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-17  33%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    2e-17  28%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-17  28%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-17  28%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-17  28%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-17  28%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-17  34%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    3e-17  29%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    3e-17  29%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    8e-17  28%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    8e-17  28%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    1e-16  28%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    1e-16  30%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    2e-16  30%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-16  30%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-16  32%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-15  29%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    2e-15  33%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-15  28%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    6e-15  28%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-15  28%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-14  30%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-14  30%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    4e-14  31%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-14  29%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-13  26%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    1e-13  26%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    1e-13  28%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-13  32%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-13  29%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-13  27%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    5e-13  27%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-13  27%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-13  27%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-13  31%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-12  30%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    2e-12  28%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-12  28%  1yqtA  [x.x.x] RNASE L INHIBITOR
    3e-12  31%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-12  32%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-12  31%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-12  31%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-12  31%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-12  26%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-12  31%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  31%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  31%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  31%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  31%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  24%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-11  30%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  30%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  31%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  31%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  28%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-11  30%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  30%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  30%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  30%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  30%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  32%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-11  28%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    4e-11  31%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    4e-11  24%  2d2fA  [x.x.x] SUFC PROTEIN
    6e-11  31%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-11  27%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-10  24%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-10  30%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  25%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-10  23%  1ji0A  [c.37.1] ABC TRANSPORTER
    9e-10  26%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-09  33%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-09  32%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    8e-09  34%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    8e-09  34%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    8e-09  34%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    8e-09  34%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    8e-09  34%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    1e-08  31%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    2e-08  31%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    5e-08  28%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-06  30%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-06  30%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-06  26%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    3e-06  26%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    5e-06  29%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-06  29%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-04  35%  1xewY  [c.37.1] SMC PROTEIN
    6e-04  33%  1xexB  [c.37.1] SMC PROTEIN
:210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSS
1l2tB           MIKLKNVTKTYGEEIIYANVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDPTEGEVYIKTNDLDDDELT
1l2tA           MIKLKNVTKTYGEEIIYANVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDPTEGEVYIKTNDLDDDELT
2pcjA           ILRAENIKKVIRGYEILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDPTEGKVFLEGKDYTNEKEL
3dhwC           MIKLSNITKVFGTRTILNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLEPTEGSVLVDGQELTTLSES
3d31A           MIEIESLSRKWKNFSL-DNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHPDSGRILLDGKDVTDLSPE
2oukB           MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDT
2oljA           MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDT
1f3oA           -IKLKNVTKTYKGEEIIKNVNLNIKEGE-FVSIGPSGSGKSTL-NIIGCLDPTEGEVYIKTNDLDDDELT
1pf4A           -VDVKDVTFTYQEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDGSICLDGHDVRDYKLT
2it1B           -IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIGIYKPTSGKIYFDEKDVTELPPK
2it1A           -IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIGIYKPTSGKIYFDEKDVTELPPK
1q12A           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPA
3fh6A           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPA
2awoA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPA
2awnB           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPA
2r6gB           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPA
2r6gA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPA
1g6hA           ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVIGFLKADEGRVYFENKDITNKEPA
1oxvA           -IIVKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDPSTGELYFDDRLVASVPPE
1oxsC           -IIVKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDPSTGELYFDDRLVASVPPE
1gajA           ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVIGFLKADEGRVYFENKDITNKEPA
1g9xA           ILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVIGFLKADEGRVYFENKDITNKEPA
1g291           -VRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEPSRGQIYIGDKLVADPEKG
2yyzA           -IRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLGIYKPTSGEIYF--DDVLVNDIP
2hydA           -IDIDHVSFQYNDNEILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRF--YDGQILIDGHNIKDFLTG
3gfoA           -------------------INMNIKRGEVTAILGGNGVGKSTLFNFNGILKPSSGRILFDNKPIDSRKGI
3g60A           -LEFKNIHFSYPSRQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLDPLDGMVSIDGQDIRTINVR
3g5uA           -LEFKNIHFSYPSRQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLDPLDGMVSIDGQDIRTINVR
1b0uA           --------KRYGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEPSEGAIIVNGQNINLVRDK
1mt0A           ---------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPENGQVLIDGHDLA-LADP
2ff7A           ---------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPENGQVLIDGHDLA-LADP
1sgwA           -LEIRDLSVGY-DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTLKPLKGEIIYNGVPITKVKGK
1xefA           ---------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPENGQVLIDGHDLA-LADP
2fgkA           ---------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPENGQVLIDGHDLA-LADP
2ffbA           ---------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPENGQVLIDGHDLA-LADP
2ffaA           ---------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPENGQVLIDGHDLA-LADP
3b5jA           ---------------ILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYPENGQVLIDGHDLA-LADP
2onkA           -------------------LNVDFEMGRDYCLLGPTGAGKSVFLELIGIVKPDRGEVRLNGADITPLPPE
3fvqB           -LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEPDSGEISLSGKTIFSKNTN
3fvqA           -LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEPDSGEISLSGKTIFSKNTN
1mv5D           MLSARHVDFAYDDSEILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFQPTAGEITIDGQPIDNI-SL
1mv5A           MLSARHVDFAYDDSEILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFQPTAGEITIDGQPIDNI-SL
2ghiA           -IEFSDVNFSYPKQRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRN
1jj7A           LVQFQDVSFAYPNRPVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLQPTGGQLLLDGKPLPQYEHR
2yz2B           -IEVVNVSHIFHEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVGLIEPTSGDVLYDGERKKGYE--
2yz2A           -IEVVNVSHIFHEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVGLIEPTSGDVLYDGERKKGYE--
2d62A           -VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEKG
2ghiC           -IEFSDVNFSYPKQRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRN
2awnC           ------------------DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLG-------------------
2ghiB           -IEFSDVNFSYPKQRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRN
2zu0C           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPE
2d3wA           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPE
2awoC           ------------------DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPA
1oxxK           -IIVKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDPSTGELYFDDRLVASVPPE
1xmiB           --ELFEKAKSFSNFSLLGDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
2d3wB           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPE
1z47B           -IEFVGVEKIYGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLEPTKGDVWIGGKRVTDLPPQ
1z47A           -IEFVGVEKIYGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLEPTKGDVWIGGKRVTDLPPQ
2d3wD           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPE
2nq2C           ------------ENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLGKIEVYQSIGFV----------P
2d3wC           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPE
2ghiD           ---------NFSYHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRN
2ixfD           --------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLQPTGGKVLLDGEPLVQY-DH
2ixfC           --------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLQPTGGKVLLDGEPLVQY--D
2ixfA           --------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLQPTGGKVLLDGEPLVQY--D
2nq2D           --------------QAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLGKIEVYQSIGFV----------P
1v43A           -VKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEPTEGRIYFGDRDVTYLPPK
2ixeD           --------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLQPTGGKVLLDGEPLVQYD--
1yqtA           --------------------------GEVIGIVGPNGIGKTTFVKLAGVEEPTEGKIEW---DLTVAYKP
2pzgB           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
2pzfA           -VVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
1xmiD           --ELFEDSLSFSNFSLLGDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
2pzgA           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
2pzeB           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
2pzeA           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
2ixeA           --------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLQPTGGKVLLDGEPLVQY--D
2bbsA           ---------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
2bbtB           ---------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
1xmiE           ---------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
1xmiC           ---------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
1xmiA           ---------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
1vplA           -VVVKDLRKRIGKKEILKXXXXXXXXXXXXXXXXPNGAGKTTTLRIISTLKPSSGIVTVFGKNVVEEPHE
1r10A           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0zD           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0zC           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0zB           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0zA           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0xD           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0xC           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0xB           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0xA           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0wC           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0wB           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1r0wA           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1q3hD           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1q3hC           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1q3hB           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1q3hA           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
2bbtA           ---------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
2bbsB           ---------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
3b60A           -LEFRNVTFTYPGREVLRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDGHILMDGHDLREYTLA
1xfaA           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1xf9D           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1xf9C           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1xf9B           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
1xf9A           ---------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLIGELEASEGIIKHSGR--------
2pzfB           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
1z2rA           --EFRNVTFTYPGREVLRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDGHILMDGHDLREYTLA
2pjzA           MIQLKNVGITLSERFSLENINLEVNGEKVI-ILGPNGSGKTTLLRAISGLLPYSGNIFINGRNYIRYSTN
2d2fA           -LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTGEILLDGENILELSPD
1xmjA           ---------AFWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
3bk7A           LVEYPRLVKDYGSFKLEVEPG-EIRKGEVIGIVGPNGIGKTTFVKMLGVEEPTEGKVEW---DLTVAYKP
2d2eA           -LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTGEILLDGENILELSPD
2bboA           ---------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSEGKIKHSGR--------
2ixgA           --------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLQPTGGKVLLDGEPLVQY--D
1ji0A           VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIGLVRAQKGKIIFNGQDITN-KPA
2cbzA           -----------------NGITFSIPEGALVAVVGQVGCGKSSLLSLLAEMDKVEGHVAIKGS--------
2ihyA           LIQLDQIGRKQG-KTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPTSGTVNLFGK--PGY-SA
2ihyB           LIQLDQIGRKQG-KTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPTSGTVNLFGKPGKVGYSA
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2qi9C           IVQLQDVAES----TRLGPLSGEVRAGEILHLVGPNGAGKSTLLARAG--TSGKGSIQFAGQPLEAWSAT
1l7vC           IVQLQDVAES----TRLGPLSGEVRAGEILHLVGPNGAGKSTLLARAG--TSGKGSIQFAGQPLEAWSAT
2awnA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPA
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           -----EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA-----NGQV--DGFPTQEECRT
2iwhB           -----EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA-----NGQV--DGFPTQEECRT
2awoD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
2awnD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
1xewY           ----------------------------------------------------------------------
1xexB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES
1l2tB           KIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEANHKPNQLSGGQQ
1l2tA           KIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEANHKPNQLSGGQQ
2pcjA           SLLRNKLGFVFQFHYLIPELTALENVIVPMLKMGKPKKEAKERGEYLLSELGLGD-KLSRKPYELSGGEQ
3dhwC           ELTRRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKH-DSYPSNLSGGQK
3d31A           ---KHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHL----LDRNPLTLSGGEQ
2oukB           NLVREEVGMVFQRFNLFPHMTVLNNITLAPMKRKWPREKAEAKAMELLDKVGLAYPD------SLSGGQA
2oljA           NLVREEVGMVFQRFNLFPHMTVLNNITLAPMKRKWPREKAEAKAMELLDKVGLAYPD------SLSGGQA
1f3oA           KIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGASGEE-RRKRALECLKA---ELEERFAQLSGGQQ
1pf4A           NLRRH-FALVSQNVHLF-NDTIANNIAYAAEGEYTREQEQAARQAHAMEFIENMPQGLDTVIGELSGGQR
2it1B           D---RNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKL-LNRYPWQLSGGQQ
2it1A           D---RNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKL-LNRYPWQLSGGQQ
1q12A           E---RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
3fh6A           E---RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
2awoA           E---RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
2awnB           E---RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
2r6gB           E---RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
2r6gA           E---RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
1g6hA           ELYHYGIVRTFQTPQPLKEMTVLENLLIGLFYKKWIPKEEEMVEKKILEFLKLSHL-YDRKAGELSGGQM
1oxvA           D---RKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHV-LNHFPRELSGGQQ
1oxsC           D---RKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHV-LNHFPRELSGGQQ
1gajA           ELYHYGIVRTFQTPQPLKEMTVLENLLIGEINKKWIPKEEEMVEKKILEFLKLSHL-YDRKAGELSGGQM
1g9xA           ELYHYGIVRTFQTPQPLKEMTVLENLLIGEINKKWIPKEEEMVEKKILEFLKLSHL-YDRKAGELSGGQM
1g291           IFVPRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTEL-LNRKPRELSGGQR
2yyzA           PKYR-EVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNL-LDRKPTQLSGGQQ
2hydA           SL-RNQIG-LVQQDNILFSDTVKENILLGATDEEVVEAAKMANAHDFIMNLPQGYTEVGERGVKLSGGQK
3gfoA           MKLRESIGIVFQDDNQLFSASVYQDVSFGAVNMKLPEDEIRKRVDNALKRTGIEHLK-DKPTHCLSFGQK
3g60A           -YLREIIGVVSQEPVLFAT-TIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGELSGGQK
3g5uA           -YLREIIGVVSQEPVLFAT-TIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGELSGGQK
1b0uA           DLLRTRLTMVFQHFNLWSHMTVLENVMIQVLG--LSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQ
1mt0A           NWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGELSGGQR
2ff7A           NWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGELSGGQR
1sgwA           IFF------LPEEIIVPRKISVEDYLKASLYGVKVNKNEIM----DALESVEV--LDLKKKLGELSQGTI
1xefA           NWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGELSGGQR
2fgkA           NWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGELSGGQR
2ffbA           NWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGELSGGQR
2ffaA           NWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGELSGGQR
3b5jA           NWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGELSGGQR
2onkA           ---RRGIGFVPQDYALFPHLSVYRNIAYGLXXXXXXXXXXXXXXMA--EKLGIAHL-LDRKPARLSGGER
3fvqB           LPVRRRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISEL-AGRYPHELSGGXX
3fvqA           LPVRRRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISEL-AGRYPHELSGGXX
1mv5D           ENWRSQIGFVSQDSAIMAG-TIRENLTYGLEGQVLDLAFARSFVENMPDQLNT---EVGERGVKISGGQR
1mv5A           ENWRSQIGFVSQDSAIMAG-TIRENLTYGLEGQVLDLAFARSFVENMPDQLNT---EVGERGVKISGGQR
2ghiA           SI-RSIIGIVPQDT-ILFNETIKYNIKLDATDEEVIKATKSAQLYDFIEALPKKWDTIGNKGMKLSGGER
1jj7A           YLHRQAVGQEPQVFG----RSLQENIAYGLTQEEITAAAVKSGAHSFISGLPQGYTEVDEAGSQLSGGQR
2yz2B           --IRRNIGIAFQ---YPEDQFFAERVEVAFAVKNFYPDRDPVLVKKAMEFVGLDFDSFKDRVFFLSGGEK
2yz2A           --IRRNIGIAFQ---YPEDQFFAERVEVAFAVKNFYPDRDPVLVKKAMEFVGLDFDSFKDRVFFLSGGEK
2d62A           VFVKERDVAVFQSYALYPH-TVYDNIAFPLKLRKVPKQEIDKRVREVAE-LGLTEL-LNRKPRELSGGQR
2ghiC           SI-RSIIGIVPQDT-ILFNETIKYNILYG----KLDATEEVIKSAQLYDFIEALPKKWDTIVGGMKLGER
2awnC           ------VGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
2ghiB           SI-RSIIGIVPQDT-ILFNETIKYNIKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKMKLSGGER
2zu0C           DRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFQDLMEEKIALLKMPEDLLTFSGGEK
2d3wA           DRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFQDLMEEKIALLKMPEDLLTFSGGEK
2awoC           E---RGVGMV----ALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQR
1oxxK           D---RKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHV-LNHFPRELSGXXX
1xmiB           ------ISFCSQ-FSWIMPGTIKENIIAGV-------SYDEYRYRSVIKACQLEE-DISKIVLTLSGGQR
2d3wB           DRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFQDLMEEKIALLKMPEDLLTFSGGEK
1z47B           ---KRNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESY-ANRFPHELSGGXX
1z47A           ---KRNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESY-ANRFPHELSGGXX
2d3wD           DRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFQDLMEEKIALLKMPEDLLTFSGGEK
2nq2C           QFFSSPFAYSVLDIVLMGRST-----HINTFAKPKSHDYQVAMQ--ALDYLNLTHLA--KREFSLSGGQR
2d3wC           DRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFQDLMEEKIALLKMPEDLLTFSGGEK
2ghiD           SI-RSIIGIVPQDT-ILFNETIKYNILYG----KLDATDEEVIKATKSAQLYDFIEALPKKTIVLSGGER
2ixfD           HYLHTQVAAVGQ---LLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFTEVGETGNQLSGGQR
2ixfC           HHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFTEVGETGNQLSGGQR
2ixfA           HHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFTEVGETGNQLSGGQR
2nq2D           QFFSSPFAYSVLDIVLMGRST-----HINTFAKPKSHDYQVAMQ--ALDYLNLTHLA--KREFSLSGGQR
1v43A           D---RNISMVFQ------HMTVYENIAFPL--KKFPKDEIDKRVRWAAELLQIEEL-LNRYPAQLSGGXX
2ixeD           ---HHYLHTQVAAVGLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVQLSGGQR
1yqtA           QYIKADYGTVYELLSKIDASKLNSNFY----------------KTELLKPLGIIDL-YDREVNELSGGEL
2pzgB           ------ISFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
2pzfA           ------ISFCSQ-FSWIMPGTIKENI----IG--VSYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
1xmiD           ------ISFCSQ-FSWIMPGTIKENIIAGV-----SYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
2pzgA           ------ISFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
2pzeB           ------ISFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
2pzeA           ------ISFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
2ixeA           HHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFTEVGETGNQLSGGQR
2bbsA           ------ISFCSQNSWIMPG-TIKENI----IG--VSYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
2bbtB           ------ISFCSQNSWIMPG-TIKENI----IG--VSYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
1xmiE           ------ISFCSQ-FSWIMPGTIKENIIAGV-----SYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
1xmiC           ------ISFCSQ-FSWIMPGTIKENIIAGV-----SYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
1xmiA           ------ISFCSQ-FSWIMPGTIKENIIAGV-----SYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
1vplA           --VRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKD-RVSTYSKGMV
1r10A           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0zD           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0zC           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0zB           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0zA           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0xD           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0xC           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0xB           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0xA           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0wC           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0wB           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1r0wA           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1q3hD           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1q3hC           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1q3hB           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1q3hA           ------VSFCSQ-FSWIMPGTIKENIIFGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
2bbtA           ------ISFCSQNSWIMPG-TIKENI----IG--VSYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
2bbsB           ------ISFCSQNSWIMPG-TIKENI----IG--VSYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
3b60A           S-LRNQVALVSQNVHLF-NDTVANNIAYART-EEYSREEEAARMAYAMDFINKMDNGLDTIIGELSXXXX
1xfaA           ------VSFCSQ-FSWIMPGTIKENIIRGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1xf9D           ------VSFCSQ-FSWIMPGTIKENIISGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1xf9C           ------VSFCSQ-FSWIMPGTIKENIISGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1xf9B           ------VSFCSQ-FSWIMPGTIKENIISGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
1xf9A           ------VSFCSQ-FSWIMPGTIKENIISGV-----SYDEYRYKKACQLQQDITKFAEQDNTVLTLSGGQR
2pzfB           ------ISFCSQ-FSWIMPGTIKENI----IG--VSYDEYRYRKACQLEEDISKFAEKDNIVLTLSGGQR
1z2rA           S-LRNQVALVSQNVHLF-NDTVANNIAYART-EEYSREEEAARMAYAMDFINKMDNGLDTIIGELSXXXX
2pjzA           LPEAYEIGYLYEELKGLDRDLFLEMLKALKLGEEILR----------------------RKLYKLSAGQS
2d2fA           ERARKGLFLAFQYPVEVPGVTIANFLRLALLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEFSGGEK
1xmjA           ------ISFCSQ-FSWIMPGTIKEN----IIG--VSYDEYRYRKACQLEEDISKFAEKDNIVITLSEGQQ
3bk7A           QYIKAEYGTVYELLSKIDSSKLNSNFY----------------KTELLKPLGIIDL-YDRNVEDLSGGEL
2d2eA           ERARKGLFLAFQ-YPVVPGVTIANFLRLALLGREVGVAEFWTKVKKALE-----LLDWDESYLSLNEGEK
2bboA           ------ISFCSQ-FSWIMPGTIKENIIFG-----VSYDEYRYRKACQLEEDISKFAEKDNIVITLSEGQQ
2ixgA           HHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFTEVGETGNQLAVGQR
1ji0A           HVINRGIALVPEGRRIFPELTVYEN--LGAYNRK-----DKEGIKRDLEWIFSLFPRLKERLKQLGGGGE
2cbzA           ------VAYVPQQ-AWIQNDSLRENI---LFGCQLEEPYYRSVIQACALLPDLEILEIGEKGVNLSGGQK
2ihyA           ETVRQHIG--FVSHSLLEKFQEGERV-IDVVISGAIDDEIRNEAHQLLKLVGSA--KAQQYIGYLSTGEK
2ihyB           ETVRQHIGFVSHSL-LEKFQEGERVIDVVISGAFKSDDEIRNEAHQLLKLVGSA--KAQQYIGYLSTGEK
2vf8B           ------------------------------------------RALDTLREVGLGYLRLGQPATELSGGEA
2vf8A           ------------------------------------------RALDTLREVGLGYLRLGQPATELSGGEA
2vf7C           ------------------------------------------RALDTLREVGLGYLRLGQPATELSGGEA
2vf7B           ------------------------------------------RALDTLREVGLGYLRLGQPATELSGGEA
2vf7A           ------------------------------------------RALDTLREVGLGYLRLGQPATELSGGEA
2qi9C           KLALHR-AYLSQQQTPPFATPVWHYLTL--------HQHDKTRTELLNDVAGALALDLGRSTNQLSGGEW
1l7vC           KLALHR-AYLSQQQTPPFATPVWHYLTL--------HQHDKTRTELLNDVAGALALDLGRSTNQLSGGEW
2awnA           E---RGVGMVFQSYA------------LEVINQRVNQVAEVL----------------------------
2r6fB           ------------------------------------------RKLETLYDVGLGY-KLGQPATTLSGGEA
2r6fA           ------------------------------------------RKLETLYDVGLGY-KLGQPATTLSGGEA
2ix3A           VYVEHDID------GTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEMIAMP-------ISALSGGWK
2iwhB           VYVEHDID------GTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEMIAMP-------ISALSGGWK
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1xewY           -----------------------------------------------------------KRIEAMSGGEK
1xexB           -----------------------------------------------------------KRIEAMSGGEK


                         +         .         .         .         .         *         .:210
query           QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTMDHxx
1l2tB           QRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHD-----------------
1l2tA           QRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHD-----------------
2pcjA           QRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAELTHRTLEM----
3dhwC           QRVAIARALASNPKVLLCDEATSALDPATTRSILEL---LKDINRTILLITH------------------
3d31A           QRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLITHD-----------------
2oukB           QRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFREVGDRVLFMD---
2oljA           QRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFREVGDRVLFMD---
1f3oA           QRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDGKTVVVVTHD-----------------
1pf4A           QRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQ-KNKTVLVIAHRLSTIEQADEILVVD---
2it1B           QRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITVYVTHDQAALAMADRI-------
2it1A           QRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITVYVTHDQAALAMADRI-------
1q12A           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLD---
3fh6A           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLD---
2awoA           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLD---
2awnB           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLD---
2r6gB           QRVAIGRTLVAEPSVFLLDQPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLD---
2r6gA           QRVAIGRTLVAEPSVFLLDQPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLD---
1g6hA           KLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEH------------------
1oxvA           QRVALARALVKDPSLLLLDEPFSNLDDSARALVKEVQSRL---GVTLLVVSHDPAIFAIAD---------
1oxsC           QRVALARALVKDPSLLLLDEPFSNLDDSARALVKEVQSRL---GVTLLVVSHDPAIFAIAD---------
1gajA           KLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEH------------------
1g9xA           KLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEH------------------
1g291           QRVALGRAIVRKPQVFLMDEPLSNLD--------------------------------------------
2yyzA           QRVALARALVKQPKVLLFDEPLSNLD-ANLRMIM------------------------------------
2hydA           QRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVA-HRLSTITHADKIVVIEN--
3gfoA           KRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKE---------------------------
3g60A           QRIAIARALVRNPKILLLDEATSALD-TESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFD---
3g5uA           QRIAIARALVRNPKILLLDEATSALD-TESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFD---
1b0uA           QRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTH------------------
1mt0A           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNADRIIVME---
2ff7A           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNADRIIVME---
1sgwA           RRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISS-------------------
1xefA           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTV-KNADRIIVME---
2fgkA           QRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNADRIIVME---
2ffbA           QRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNADRIIVME---
2ffaA           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTV-KNADRIIVME---
3b5jA           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNADRIIVME---
2onkA           QRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVREFDVPILHVTHDLIEAAMADEVAVM----
3fvqB           XXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHD-----------------
3fvqA           XXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHD-----------------
1mv5D           QRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIA-HRLSTIVDADKIYFIE---
1mv5A           QRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIA-HRLSTIVDADKIYFIE---
2ghiA           QRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIA--------------------
1jj7A           QAVALARALIRKPCVLILDDATSALD-ANSQLQVEQLLSPERYSRSVLLITQHLSLVEQADHILFLE---
2yz2B           RRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHD-----------------
2yz2A           RRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHD-----------------
2d62A           QRVALGRAIIRRPKVFL-DEPLSNLD--------------------------------------------
2ghiC           QRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIA--------------------
2awnC           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLD---
2ghiB           QRIAIARCLLKDPKIVIFDEATS--DSKTEYLFQKAVEDLRKNRTLIIIA--------------------
2zu0C           KRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTH------------------
2d3wA           KRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTH------------------
2awoC           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLD---
1oxxK           XXXXXXXXXXKDPSLLLLDEPFSNLDDSARALVKEVQSRL---GVTLLVVSHDPAIFAIAD---------
1xmiB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
2d3wB           KRNDILQMAVLEPELCILDE-SDSLDIDALKVVADGVNSLRDGKRSFIIVTH------------------
1z47B           XXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTVFVTHDEEALEVADRVLVL----
1z47A           XXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTVFVTHDEEALEVADRVLVL----
2d3wD           KRNDILQMAVLEPELCILDE-SDGLDIDALKVVADGVNSLRDGKRSFIIVTH------------------
2nq2C           QLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLQSQNMTVVFTTHQP----------------
2d3wC           KRNDILQMAVLEPELCILDE---SDDIDALKVVADGVNSLRDGKRSFIIVTH------------------
2ghiD           QRIAIARCLLKDPKIVIFD------DSKTEYLFQKAV----EDNRTLIIIAHRLSTISSAESIILLN---
2ixfD           QAVALARALIRKPRLLILDQATSALD-AGNQLRVQRLLSPEWASRTVLLITHQLSLAERAHHI-------
2ixfC           QAVALARALIRKPRLLILDQATSALD-AGNQLRVQRLLSPEWASRTVLLITHQLSLAERAHHI-------
2ixfA           QAVALARALIRKPRLLILDQATSALD-AGNQLRVQRLLSPEWASRTVLLITHQLSLAERAHHI-------
2nq2D           QLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLQSQNMTVVFTTHQP----------------
1v43A           XXXXXXXXXXXEPDVLLMDEPLSNLD--------------------------------------------
2ixeD           QAVALARALIRKPRLLILDNATSALD-AGNQLRVQRLLSPEWASRTVLLITQQLSLAERAHHI-------
1yqtA           QRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDVLIDYVSDRL-------
2pzgB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
2pzfA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
1xmiD           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
2pzgA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
2pzeB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
2pzeA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
2ixeA           QAVALARALIRKPRLLILDNATSALD-AGNQLRVQRLLSPEWASRTVLLITQQLSLAERAHHI-------
2bbsA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
2bbtB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
1xmiE           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
1xmiC           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
1xmiA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
1vplA           RKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHN-----------------
1r10A           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0zD           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0zC           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0zB           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0zA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0xD           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0xC           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0xB           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0xA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0wC           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0wB           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1r0wA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1q3hD           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1q3hC           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1q3hB           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1q3hA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
2bbtA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
2bbsB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
3b60A           XXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIA--------------------
1xfaA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1xf9D           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1xf9C           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1xf9B           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
1xf9A           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILIL----
2pzfB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
1z2rA           XXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIA--------------------
2pjzA           VLVRTSLALASQPEIVGLDEPFENVDAARRHVISRY---IKEYGKEGILVTH------------------
2d2fA           KRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITH------------------
1xmjA           AKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
3bk7A           QRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNKTALVVEHD-----------------
2d2eA           KRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITH------------------
2bboA           AKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL----
2ixgA           QAVALARALIRKPRLLILDNATSALD-AGNQLRVQRLLSPEWASRTVLLITQQLSLAERAHHI-------
1ji0A           QQLAIGRALSRPK---LLDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQN-----------------
2cbzA           QRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGKNKTRILVTHSMSYLPQVDVIIVM----
2ihyA           QRVIAR--ALGQPQVLILDEPAAGLD--------------------------------------------
2ihyB           QRVIAR--ALGQPQVLILDEPAAGLD--------------------------------------------
2vf8B           QRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWV-------
2vf8A           QRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWV-------
2vf7C           QRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWV-------
2vf7B           QRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWV-------
2vf7A           QRIKLATELRRSGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWV-------
2qi9C           QRVRLAAVVLQITPLLLLDEPN-SLDVA-QQSALDKILSALSQQGLAIVSSHD-----------------
1l7vC           QRVRLAAVVLQITPLLLLDEPN-SLDVAQQSALDKILSALCQQG-LAIVSSHD-----------------
2awnA           ---AIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVAMTLADKIVVLD---
2r6fB           QRVKLAAELHRRSTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDL----
2r6fA           QRVKLAAELHRRSTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDL----
2ix3A           MKLALARAVLRNADILLLDEPTNHLD--------------------------------------------
2iwhB           MKLALARAVLRNADILLLDEPTNHLD--------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1xewY           ALTALAFVFFKPAPFYLFDEIDAHLDDANVKRVADLIKESSKESQFIVI---------------------
1xexB           ALTALAFVFFKPAPFYLFDQIDAHLDDANVKRVADLIKESSKESQFIVI---------------------