[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56413.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1kskA.bssp"
#ERROR : Can't open dsspfile "1vioA.bssp"
#ERROR : Can't open dsspfile "3dh3C.bssp"
#ERROR : Can't open dsspfile "3dh3B.bssp"
#ERROR : Can't open dsspfile "3dh3A.bssp"
#ERROR : Can't open dsspfile "2omlA.bssp"
#ERROR : Can't open dsspfile "2olwB.bssp"
#ERROR : Can't open dsspfile "2olwA.bssp"
#ERROR : Can't open dsspfile "2gmlA.bssp"

## Summary of PDB Search
:240
    5e-38  41%  1kskA  [d.66.1 - d.265.1] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE
    2e-30  35%  1vioA  [d.66.1 - d.265.1] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE
    2e-28  34%  3dh3C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    2e-28  34%  3dh3B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    2e-28  34%  3dh3A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    1e-21  39%  2omlA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE E
    1e-21  39%  2olwB  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE E
    1e-21  39%  2olwA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE E
    3e-19  39%  2gmlA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
:240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEFVYYMMNKPKG
1kskA           -RLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHD-VAYDGNPLAQQHGPRYFLNKPQG
1vioA           LRLDKFIAENVGLTRSQATKAIRQSAVKINGEIVKSGSVQISQE-DEIYFEDELLTWEEGQYFMLNKPQG
3dh3C           VRLNKYISESGICSRREADRYIEQGNVFLNGKRAT-----IGDQVDVVKVNGQLIEAEDLVLIALNKPVG
3dh3B           VRLNKYISESGICSRREADRYIEQGNVFLNGKRAT-----IGDQVDVVKVNGQLIEAEDLVLIALNKPVG
3dh3A           VRLNKYISESGICSRREADRYIEQGNVFLNGKRAT-----IGDQVDVVKVNGQLIEAEDLVLIALNKPVG
2omlA           ---------------------------------------------------------------LFNKPYD
2olwB           ---------------------------------------------------------------LFNKPYD
2olwA           ---------------------------------------------------------------LFNKPYD
2gmlA           ----------------------------------------------------------DLVLIALNKPVG


                         .         .         *         .         .         .         .:140
query           VISATEDPKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGI
1kskA           YVCSTDDPDHPTVLYFLDEPVAWK-LHAAGRLDIDTTG-LVLTDDGQWSHRITSPRHHCEKTYLVTLESP
1vioA           CVCSNDD--YPTIYQFFDYPLAGK-LHSAGRXXXXXXXXXXXXXXXQWSHRITSPKHHCEKTYLVTLADP
3dh3C           IVSTTEDGERDNIVDFVN---HSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
3dh3B           IVSTTEDGERDNIVDFVN---HSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
3dh3A           IVSTTEDGERDNIVDFVN---HSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
2omlA           VLPQFTDEAGRKTLK---EFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGI
2olwB           VLPQFTDEAGRKTLK---EFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGI
2olwA           VLPQFTDEAGRKTLK---EFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGI
2gmlA           IVSTTEDGERDNIVDFVN---HSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP


                         +         .         .         .         .         *         .:210
query           MTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTM
1kskA           VADDTAEQFAKGVQLKDLT-KPAVLEVIT------PTQVRLTISEGRYHQVKRFAA-VGNHVVELHRERI
1vioA           VEENYSAACAEGILLRGEKTKPAKLEIL------DDYNVNLTISEGRYHQVKRMFAALGNKVVGLHRWKI
3dh3C           ITEEFIRGMSAGVPILGTVTKKCKVK------KEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
3dh3B           ITEEFIRGMSAGVPILGTVTKKCKVK------KEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
3dh3A           ITEEFIRGMSAGVPILGTVTKKCKVK------KEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
2omlA           PTQDALEALRNGVTLNDGPTLPAGAELVDEPAPRNTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAM
2olwB           PTQDALEALRNGVTLNDGPTLPAGAELVDEPAPRNTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAM
2olwA           PTQDALEALRNGVTLNDGPTLPAGAELVDEPAPRNTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAM
2gmlA           ITEE----FIRG---------SAGVPILGTVTKKCKVKFRITLVQGLNRQIRRCEHF-GYEVKKLERTRI


                         .         .         .         +         .         .         .:280
query           GTLVLDENLERGEWRRLTKEELEILxxxxx
1kskA           GGITLDADLAPGEYRPLTEEEI--------
1vioA           GDVVLDESLEEGEYRPLTQSEIEKL-----
3dh3C           MNVSL-SGIPLGEWRDLTDDEL--------
3dh3B           MNVSL-SGIPLGEWRDLTDDEL--------
3dh3A           MNVSL-SGIPLGEWRDLTDDEL--------
2omlA           GDYSLD-NLANGEWREVT------------
2olwB           GDYSLD-NLANGEWREVT------------
2olwA           GDYSLD-NLANGEWREVT------------
2gmlA           NVSL--SGIPLGEWRDLTDDEL--------