[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56432.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2z23A.bssp"
#ERROR : Can't open dsspfile "1b52A.bssp"
#ERROR : Can't open dsspfile "1b0hA.bssp"
#ERROR : Can't open dsspfile "1dppA.bssp"
#ERROR : Can't open dsspfile "1dpeA.bssp"
#ERROR : Can't open dsspfile "3ftoA.bssp"
#ERROR : Can't open dsspfile "3drjA.bssp"
#ERROR : Can't open dsspfile "3drhA.bssp"
#ERROR : Can't open dsspfile "3drgA.bssp"
#ERROR : Can't open dsspfile "3drfA.bssp"
#ERROR : Can't open dsspfile "1zu0A.bssp"
#ERROR : Can't open dsspfile "1ztyA.bssp"
#ERROR : Can't open dsspfile "2nooA.bssp"
#ERROR : Can't open dsspfile "1zlqB.bssp"
#ERROR : Can't open dsspfile "1zlqA.bssp"
#ERROR : Can't open dsspfile "1xocA.bssp"
#ERROR : Can't open dsspfile "1uivA.bssp"
#ERROR : Can't open dsspfile "1uiuA.bssp"
#ERROR : Can't open dsspfile "3e3kB.bssp"
#ERROR : Can't open dsspfile "3dp8C.bssp"
#ERROR : Can't open dsspfile "3dp8B.bssp"
#ERROR : Can't open dsspfile "3dp8A.bssp"
#ERROR : Can't open dsspfile "1uqwA.bssp"

## Summary of PDB Search
:652
    1e-30  30%  2z23A  [x.x.x] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    3e-27  29%  1b52A  [c.94.1] PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
    4e-26  30%  1b0hA  [c.94.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    7e-16  34%  1dppA  [c.94.1] DIPEPTIDE BINDING PROTEIN
    1e-15  37%  1dpeA  [x.x.x] DIPEPTIDE-BINDING PROTEIN
    8e-12  31%  3ftoA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    8e-12  32%  3drjA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    8e-12  32%  3drhA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    8e-12  32%  3drgA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    8e-12  32%  3drfA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN OPPA
    1e-11  30%  1zu0A  [x.x.x] CHITIN OLIGOSACCHARIDE BINDING PROTEIN
    1e-11  30%  1ztyA  [x.x.x] CHITIN OLIGOSACCHARIDE BINDING PROTEIN
    6e-07  31%  2nooA  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-06  50%  1zlqB  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-06  50%  1zlqA  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-06  26%  1xocA  [x.x.x] OLIGOPEPTIDE-BINDING PROTEIN APPA
    4e-06  50%  1uivA  [c.94.1] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-06  50%  1uiuA  [c.94.1] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-06  50%  3e3kB  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-06  50%  3dp8C  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-06  50%  3dp8B  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    4e-06  50%  3dp8A  [x.x.x] NICKEL-BINDING PERIPLASMIC PROTEIN
    1e-05  27%  1uqwA  [c.94.1] PUTATIVE BINDING PROTEIN YLIB
:652

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLEN
2z23A           ----------------------------------------SEPQSLDPHKIEGVPESNISRDLLEGLVIN
1b52A           -------------------------------------VQSLDPHKIEGVPE-----SNVSRDLFEGLLIS
1b0hA           -------------------------------------VQSLDPHKIEGVPE-----SNVSRDLFEGLLIS
1dppA           --------------------------------KTLVYCSEGSPEGFNPQLFTSGTTYDASSVPLYNRLVE
1dpeA           ----------------------------------------------------------------------
3ftoA           ----------------------------------------------------------------DGLFFT
3drjA           ----------------------------------------------------------------DGLFFT
3drhA           ----------------------------------------------------------------DGLFFT
3drgA           ----------------------------------------------------------------DGLFFT
3drfA           ----------------------------------------------------------------DGLFFT
1zu0A           -----------------------------------------------YLATNLRTTTDFIYEPL--VVFN
1ztyA           -----------------------------------------------YLATNLRTTTDFIYEPL--VVFN
2nooA           ----------------------------------------------------------------------
1zlqB           ----------------------------------------------------------------------
1zlqA           ----------------------------------------------------------------------
1xocA           -----------------------------------------EPTLFNSLYSTDDASTDIENMLYSFLTKT
1uivA           ----------------------------------------------------------------------
1uiuA           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------
3dp8C           ----------------------------------------------------------------------
3dp8B           ----------------------------------------------------------------------
3dp8A           ----------------------------------------------------------------------
1uqwA           ------------------------------AAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLLDK


                         .         .         *         .         .         .         .:140
query           DQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDS
2z23A           DPNGNIVPGAAESWD-NKDFKVWTFNIRKDAKW--SNGD---PVTAQDFVYSWQRLADPKTYASYLQYAH
1b52A           DVEGHPSPGVAEKWE-NKDFKVWTFHLRENAKW--SDG---TPVTAHDFVYSWQRLADPNTAASYLQYGH
1b0hA           DVEGHPSPGVAEKWE-NKDFKVWTFHLRENAKW--SDG---TPVTAHDFVYSWQRLADPNTAASYLQYGH
1dppA           FKIGTVIPGLAEKWEVSEDGKTYTFHLRKGVKW--HDNKEFKPLNADDVV----FSFDRQKNAQNPYHKV
1dpeA           -----VIPGLAEKWEVSEDGKTYTFHLRKGVKW--HDNKEFKPLNADDVV----FSFDRQKNAQNPYHKV
3ftoA           DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGSE---VTAKDYIANPAYGSDRWTDSLA----N
3drjA           DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGSE---VTAKDYIANPAYGSDRWTDSLA----N
3drhA           DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGSE---VTAKDYIANPAYGSDRWTDSLA----N
3drgA           DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGSE---VTAKDYIANPAYGSDRWTDSLA----N
3drfA           DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGSE---VTAKDYIANPAYGSDRWTDSLA----N
1zu0A           EMKGNTVFRLAESYKMADDLMSVTFDIRKGVKW--SDGEAF---TADDVVYGLLKAKPELDQR-------
1ztyA           EMKGNTVFRLAESYKMADDLMSVTFDIRKGVKW--SDGEAF---TADDVVYGLLKAKPELDQR-------
2nooA           ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENFRAVLDHAALELANQIVDVK-A
1zlqB           ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENF---------------------
1zlqA           ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENF---------------------
1xocA           DEKLNVKLSLAESIKELDGGLAYDVKIKKGVKF--HDGKE---LTADDFTYSVPLSKDYKGE--------
1uivA           ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENF---------------------
1uiuA           ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENF---------------------
3e3kB           ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENF---------------------
3dp8C           ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENF---------------------
3dp8B           ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENF---------------------
3dp8A           ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENF---------------------
1uqwA           EKLKNV---LAESYTVSDDGITYTVKLREGIKF--------------------QDGTDFNAAAVKANLDR


                         +         .         .         .         .         *         .:210
query           VAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS
2z23A           LTNIDDIITGKAAP-DTLGVKALDDHTLEVTLSEPVPYLDKLLAHPLMSPVNKTVVEKFGEKW--TQPQN
1b52A           IANIDDIIAGK-KPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKW--TQPAN
1b0hA           IANIDDIIAGK-KPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKW--TQPAN
1dppA           SGGSYEYFEGMGLPELISEVKKVDDNTVQFVLTRPELADLAMDFASILSKEYADAMMKAGTP-EKLDLNP
1dpeA           SGGSYEYFEGMGLPELISEVKKVDDNTVQFVLTRPELADLAMDFASILSKEYADAMMKAGTP-EKLDLNP
3ftoA           IVGLSDYHTGKAKTIS--GITFPDGENVQFKEKPGTQSGNGYFLETV---APYQYLKDVAPKDLASSPKT
3drjA           IVGLSDYHTGKAKTIS--GITFPDGENVQFKEMKPGMTQNGYFLETV---APYQYLKDVAPKDLASSPKT
3drhA           IVGLSDYHTGKAKTIS--GITFPDGENVQFKEMKPGMTQNGYFLETV---APYQYLKDVAPKDLASSPKT
3drgA           IVGLSDYHTGKAKTIS--GITFPDGENVQFKEMKPGMTQNGYFLETV---APYQYLKDVAPKDLASSPKT
3drfA           IVGLSDYHTGKAKTIS--GITFPDGENVQFKEMKPGMTQNGYFLETV---APYQYLKDVAPKDLASSPKT
1zu0A           --GINKWVTS---------VEKVDEYKVRFRLSEA----NSNVPYEILIPIVAEHVWKDVKDPTTFTNEN
1ztyA           --GINKWVTS---------VEKVDEYKVRFRLSEA----NSNVPYEILIPIVAEHVWKDVKDPTTFTNEN
2nooA           LSKTELQITLKSAYYPFLQELAL---PAPFRFIAPSQFKNHETMNGIKAPIG------------------
1zlqB           ----------------------------------------------------------------------
1zlqA           ----------------------------------------------------------------------
1xocA           --------RGSTYEMLKSVEKKGDYEVLFKLKYKDGNFYNNALDSTAILPKNVPIADLEENEFNRKKP--
1uivA           ----------------------------------------------------------------------
1uiuA           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------
3dp8C           ----------------------------------------------------------------------
3dp8B           ----------------------------------------------------------------------
3dp8A           ----------------------------------------------------------------------
1uqwA           ASDPANHLKRHNLYKNIAKTEAIDPTTVKITLKQP----FSAFINILAHPATA-ISPAALEKYGKEIGFY


                         .         .         .         +         .         .         .:280
query           ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSS
2z23A           FVGNGAYKLKDWIVNERIVLERSPTYWDNAKTVINQV--TYLPISSEVTDVNRYRSGEIDMTYNNMPIEL
1b52A           IVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQV--TYLPISSEVTDVNRYRSGEIDMTYNNMPIEL
1b0hA           IVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQV--TYLPISSEVTDVNRYRSGEIDMTYNNMPIEL
1dppA           I-GTGPFQLQQYQKDSRIRYKAFDGYWGTK----------------------------------------
1dpeA           I-GTGPFQLQQYQKDSRIRYKAFDGYWGTK----------------------------------------
3ftoA           TLVTGPFKPENVVAGESIKYVPNPYYWGEKNSITYEVVSTAKSVAALSSSKYDIINGV---------SSQ
3drjA           TLVTGPFKPENVVAGESIKYVPNPYYWGEKNSITYEVVSTAKSVAALSSSKYDIINGMV--------SSQ
3drhA           TLVTGPFKPENVVAGESIKYVPNPYYWGEKNSITYEVVSTAKSVAALSSSKYDIINGMV--------SSQ
3drgA           TLVTGPFKPENVVAGESIKYVPNPYYWGEKNSITYEVVSTAKSVAALSSSKYDIINGMV--------SSQ
3drfA           TLVTGPFKPENVVAGESIKYVPNPYYWGEKNSITYEVVSTAKSVAALSSSKYDIINGMV--------SSQ
1zu0A           PVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQ-------LLGKIVNSELDWTSSF
1ztyA           PVGTGPFTVIDTFTPQLYIQCRNPNYWDAANLEVDCLRVPQIANNDQ-------LLGKIVNSELDWTSSF
2nooA           ---TGPWILQESKLNQYDVFVRNENYWGEK----------------------------------------
1zlqB           ----------------------------------------------------------------------
1zlqA           ----------------------------------------------------------------------
1xocA           -IGSGPFKFKEWKQGQYIKLEANDDYFEGR-PYLDTV--TYKVIPDANAAEAQLQAG---DINFFNVPAT
1uivA           ----------------------------------------------------------------------
1uiuA           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------
3dp8C           ----------------------------------------------------------------------
3dp8B           ----------------------------------------------------------------------
3dp8A           ----------------------------------------------------------------------
1uqwA           PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVAD------NNTRAALQTGEAFPIPYE


                         .         *         .         .         .         .         +:350
query           YEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYG
2z23A           FQKLKKEIPDQVHVDPYLCT-YYYEINNQKAPFTDARVREALKLGMDRDIIVNKVKNQG-----DLPAYG
1b52A           FQKLKKEIPNEVRVDPYLCT-YYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQG-----DLPAYS
1b0hA           FQKLKKEIPNEVRVDPYLCT-YYYEINNQKAPFNDVRVRTALKLALDRDIIVNK----------------
1dppA           ----------------------------------------------------------------------
1dpeA           ----------------------------------------------------------------------
3ftoA           YKQVK-NLKGYKVLGQQAYISLYYNLG------HYDAKNS-INVQDRKTPLQDQNVRQAIGYA-------
3drjA           YKQVK-NLKGYKVLGQQAMYISLMYYNLG----HYDAKNS-INVQDRKTPLQDQNVRQAIGYA-------
3drhA           YKQVK-NLKGYKVLGQQAMYISLMYYNLG----HYDAKNS-INVQDRKTPLQDQNVRQAIGYA-------
3drgA           YKQVK-NLKGYKVLGQQAMYISLMYYNLG----HYDAKNS-INVQDRKTPLQDQNVRQAIGYA-------
3drfA           YKQVK-NLKGYKVLGQQAMYISLMYYNLG----HYDAKNS-INVQDRKTPLQDQNVRQAIGYA-------
1zu0A           VPDIDR------TYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKK---EALDNVDFRRAFSMALDR----
1ztyA           VPDIDR------TYAAANPNHHYWYPAAGTQAFMVNFKNPDPAKK---EALDNVDFRRAFSMALDR----
2nooA           ----------------------------------------------------------------------
1zlqB           ----------------------------------------------------------------------
1zlqA           ----------------------------------------------------------------------
1xocA           DYKTAEKF-NNLKIVTDLALSYVY-----------------IGWNEKNELFKDKKVRQALTTALDRESIV
1uivA           ----------------------------------------------------------------------
1uiuA           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------
3dp8C           ----------------------------------------------------------------------
3dp8B           ----------------------------------------------------------------------
3dp8A           ----------------------------------------------------------------------
1uqwA           QATLLEKNKNIELASP----------SIQRYISNVTQKPFD-----------NPKVREALNYAINR----


                         .         .         .         .         *         .         .:420
query           AQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXX
2z23A           FTPPYTSGAE------LTPPEWFSWTQEKRNEVAKKLLAEAGYTKD------------NP----------
1b52A           YTPPYTDGA-----KLVEPEWFKWSQQKRNEE--AKKLLAEAGFTAPLTF----DLLYN-----------
1b0hA           ----------------------------------------------------------------------
1dppA           ----------------------------------------------------------------------
1dpeA           ----------------------------------------------------------------------
3ftoA           ----------------------------------------------------------------------
3drjA           ----------------------------------------------------------------------
3drhA           ----------------------------------------------------------------------
3drgA           ----------------------------------------------------------------------
3drfA           ----------------------------------------------------------------------
1zu0A           ----------------------------------------------------------------------
1ztyA           ----------------------------------------------------------------------
2nooA           ----------------------------------------------------------------------
1zlqB           ----------------------------------------------------------------------
1zlqA           ----------------------------------------------------------------------
1xocA           SQVLDGDGEVAYIPESPLSWNYIDVPKFEYNEKKAKQML-------------------------------
1uivA           ----------------------------------------------------------------------
1uiuA           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------
3dp8C           ----------------------------------------------------------------------
3dp8B           ----------------------------------------------------------------------
3dp8A           ----------------------------------------------------------------------
1uqwA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQ
2z23A           --------LKFSL-LYNTSDLHKKLAIAAASIWKK---------NLGVDV-KLENQEWKT---FLDTRHQ
1b52A           -----------------TSDLHKKLAIAVASIWKKNL-----GVNVNLENQEWKT--------FLDTRHQ
1b0hA           ----------------------------------------------------------------------
1dppA           ----------------------------------------------------------------------
1dpeA           ----------------------------------------------------------------------
3ftoA           ----------------------------------------------------------------------
3drjA           ----------------------------------------------------------------------
3drhA           ----------------------------------------------------------------------
3drgA           ----------------------------------------------------------------------
3drfA           ----------------------------------------------------------------------
1zu0A           ----------------------------------------------------------------------
1ztyA           ----------------------------------------------------------------------
2nooA           ----------------------------------------------------------------------
1zlqB           ----------------------------------------------------------------------
1zlqA           ----------------------------------------------------------------------
1xocA           ----------------------------------------------------------------------
1uivA           ----------------------------------------------------------------------
1uiuA           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------
3dp8C           ----------------------------------------------------------------------
3dp8B           ----------------------------------------------------------------------
3dp8A           ----------------------------------------------------------------------
1uqwA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKR
2z23A           GTYDVARAAWCADYNEP-----------------------------------------------------
1b52A           GTFDVARAGWCADYNEPTSFLNTMLSDSSN---------NTAHYKSPA-----FDKLIADTLKVADDTQR
1b0hA           ----------------------------------------------------------------------
1dppA           ----------------------------------------------------------------------
1dpeA           ----------------------------------------------------------------------
3ftoA           ----------------------------------------------------------------------
3drjA           ----------------------------------------------------------------------
3drhA           ----------------------------------------------------------------------
3drgA           ----------------------------------------------------------------------
3drfA           ----------------------------------------------------------------------
1zu0A           ----------------------------------------------------------------------
1ztyA           ----------------------------------------------------------------------
2nooA           ----------------------------------------------------------------------
1zlqB           ----------------------------------------------------------------------
1zlqA           ----------------------------------------------------------------------
1xocA           ----------------------------------------------------------------------
1uivA           ----------------------------------------------------------------------
1uiuA           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------
3dp8C           ----------------------------------------------------------------------
3dp8B           ----------------------------------------------------------------------
3dp8A           ----------------------------------------------------------------------
1uqwA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           YEKYADIQAWLIDSSLVLPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2z23A           ----------------------------------------------------------------------
1b52A           SELYAKAEQQLDKDSAIVP---------------------------------------------------
1b0hA           ----------------------------------------------------------------------
1dppA           ----------------------------------------------------------------------
1dpeA           ----------------------------------------------------------------------
3ftoA           ----------------------------------------------------------------------
3drjA           ----------------------------------------------------------------------
3drhA           ----------------------------------------------------------------------
3drgA           ----------------------------------------------------------------------
3drfA           ----------------------------------------------------------------------
1zu0A           ----------------------------------------------------------------------
1ztyA           ----------------------------------------------------------------------
2nooA           ----------------------------------------------------------------------
1zlqB           ----------------------------------------------------------------------
1zlqA           ----------------------------------------------------------------------
1xocA           ----------------------------------------------------------------------
1uivA           ----------------------------------------------------------------------
1uiuA           ----------------------------------------------------------------------
3e3kB           ----------------------------------------------------------------------
3dp8C           ----------------------------------------------------------------------
3dp8B           ----------------------------------------------------------------------
3dp8A           ----------------------------------------------------------------------
1uqwA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxx
2z23A           ----------------------
1b52A           ----------------------
1b0hA           ----------------------
1dppA           ----------------------
1dpeA           ----------------------
3ftoA           ----------------------
3drjA           ----------------------
3drhA           ----------------------
3drgA           ----------------------
3drfA           ----------------------
1zu0A           ----------------------
1ztyA           ----------------------
2nooA           ----------------------
1zlqB           ----------------------
1zlqA           ----------------------
1xocA           ----------------------
1uivA           ----------------------
1uiuA           ----------------------
3e3kB           ----------------------
3dp8C           ----------------------
3dp8B           ----------------------
3dp8A           ----------------------
1uqwA           ----------------------