[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56471.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0hA.bssp"
#ERROR : Can't open dsspfile "1b52A.bssp"

## Summary of PDB Search
:234
    1e-06  30%  1b0hA  [c.94.1] PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
    5e-06  29%  1b52A  [c.94.1] PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
:234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxADAPTTFSYVYAVDPASLGYSIATRTSTTDVIGNVIDGLMENDKYGNVAPSQ
1b0hA           ------------------ADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVN--LENQEWKTFLDTQ
1b52A           --------------------APLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVN--LENQEWKTFLDTQ


                         .         .         *         .         .         .         .:140
query           KDYDLNSTGWAPSYQDPASYLNIMDPKSGSAMKHLGITKGKDKDVVAKPGLDKYKKLLEDAVSETTDLEK
1b0hA           GTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAH-----------YKSPAFD---KLIADTLKVADDTQ-
1b52A           GTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAH-----------YKSPAFD---KLIADTLKVADDTQ-


                         +         .         .         .         .         *         .:210
query           RYEKYAKAQAWSTDSSLLMPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b0hA           RSELYAKAEQQLDKDSAIVP--------------------------------------------------
1b52A           RSELYAKAEQQLDKDSAIVP--------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxx
1b0hA           ------------------------
1b52A           ------------------------