[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:gatB

[Show Plain Result]

#ERROR : Can't open dsspfile "2g5iB.bssp"
#ERROR : Can't open dsspfile "2f2aB.bssp"
#ERROR : Can't open dsspfile "2dqnB.bssp"
#ERROR : Can't open dsspfile "2df4B.bssp"
#ERROR : Can't open dsspfile "2g5hB.bssp"
#ERROR : Can't open dsspfile "3h0lB.bssp"
#ERROR : Can't open dsspfile "2d6fC.bssp"
#ERROR : Can't open dsspfile "2d6fD.bssp"
#ERROR : Can't open dsspfile "1zq1C.bssp"

## Summary of PDB Search
:480
    e-147  63%  2g5iB  [x.x.x] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    e-146  63%  2f2aB  [x.x.x] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    e-146  64%  2dqnB  [x.x.x] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    e-145  64%  2df4B  [x.x.x] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    e-144  64%  2g5hB  [x.x.x] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    1e-99  43%  3h0lB  [x.x.x] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    7e-15  30%  2d6fC  [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    2e-14  31%  2d6fD  [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    9e-11  28%  1zq1C  [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
:480

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
2g5iB           -HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
2f2aB           ---ETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
2dqnB           --FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
2df4B           -HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
2g5hB           --FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
3h0lB           --YEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEYAIRASLALNCEV
2d6fC           MDWEKVMGLEIHQQLDTESKLFCPCRTELTDDHDIVRNLRPTAFEEAMRKLNPEALEIAVTIALLLNMRV
2d6fD           MDWEKVMGLEIHQQLDTESKLFCPTDSEPDHDIVRNLRPTRAAFEEAMRKLNPEALEIAVTIALLLNMRV
1zq1C           ---------------------------------------------------DREALEVALQIAYLLNAKP


                         .         .         *         .         .         .         .:140
query           HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
2g5iB           ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
2f2aB           ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
2dqnB           ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
2df4B           ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
2g5hB           ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
3h0lB           HEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIRRLHIEEDAGKNIHEGD-KTL
2d6fC           VDEFHTMRKQVIDGSNTGGFQRTGLVATDGH-----LETPQGTVK---IENLCLEEDAARRIRETGDGVV
2d6fD           VDEFHTMRKQVIDGSNTGGFQRTGLVATDGH-----LETPQGTVK---IENLCLEEDAARRIRETGDGVV
1zq1C           VDEVYYMRKIVIDGSNVSGFQRTAIIATDG-----KVETPWGA---VGIPTICLEEDAARIIERKDKEVI


                         +         .         .         .         .         *         .:210
query           VDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTK
2g5iB           VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTK
2f2aB           VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTK
2dqnB           VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTK
2df4B           VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTK
2g5hB           VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTK
3h0lB           VDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRPKGSKEFGTR
2d6fC           FRLDRLGIPLVEITTDPSMSDPQQLREVAYQIGQILR---STRVKRGLGTIRQDLNISIRD------GAR
2d6fD           FRLDRLGIPLVEITTDPSMSDPQQLREVAYQIGQILR---STRVKRGLGTIRQDLNISIRD------GAR
1zq1C           YRLDRLGIPLIEISTTPDIHHPEQAKVVAKFIGDALR--ATKKVKRGLGTIRQDLNVSI------KGGAR


                         .         .         .         +         .         .         .:280
query           TELKNLNSFSNVRKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDXPLF
2g5iB           AELKNLNSFNYVRKGXXXXXXXXXXXXXNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPL
2f2aB           AELKNLNSFNYVRKGXXXXXXXXXXXXXNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPL
2dqnB           AELKNLNSFNYVRKGXXXXXXXXXXXXXNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPL
2df4B           AELKNLNSFNYVRKGXXXXXXXXXXXXXNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPL
2g5hB           AELKNLNSFNYVRKGXXXXXXXXXXXXXNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPL
3h0lB           VEIKNVNSFRFVQKALEYEIERQINXXXXXXXXXXXTRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPL
2d6fC           VEVKGVQDLDLIPEIVEREVKRQLSLV-------------------------------------------
2d6fD           VEVKGVQDLDLIPEIVEREVKRQLSLV-------------------------------------------
1zq1C           IEIKGVQELDMIPIIIEREVERQLNLLKIRDELRK-----------------------------------


                         .         *         .         .         .         .         +:350
query           EIXDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAKQVSNWLQGEV
2g5iB           YIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGV
2f2aB           YIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGV
2dqnB           YIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGV
2df4B           YIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGV
2g5hB           YIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGV
3h0lB           XXXXXXXXXXXXNMPELPDQRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDL
2d6fC           ----------------------------------------------------------------------
2d6fD           ----------------------------------------------------------------------
1zq1C           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQxxxxxxx
2g5iB           NEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ-------
2f2aB           NEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ-------
2dqnB           NEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIME-------------
2df4B           NEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNA------------------
2g5hB           NEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNA------------------
3h0lB           LGLLRDKGISIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGL---------
2d6fC           ----------------------------------------------------------------------
2d6fD           ----------------------------------------------------------------------
1zq1C           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2g5iB           ------------------------------------------------------------
2f2aB           ------------------------------------------------------------
2dqnB           ------------------------------------------------------------
2df4B           ------------------------------------------------------------
2g5hB           ------------------------------------------------------------
3h0lB           ------------------------------------------------------------
2d6fC           ------------------------------------------------------------
2d6fD           ------------------------------------------------------------
1zq1C           ------------------------------------------------------------