[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:metB

[Show Plain Result]

#ERROR : Can't open dsspfile "1ibjA.bssp"
#ERROR : Can't open dsspfile "1n8pA.bssp"
#ERROR : Can't open dsspfile "3e6gA.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "3cogD.bssp"
#ERROR : Can't open dsspfile "2nmpD.bssp"
#ERROR : Can't open dsspfile "2nmpC.bssp"
#ERROR : Can't open dsspfile "2nmpB.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "1e5eA.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "2nmpA.bssp"
#ERROR : Can't open dsspfile "3elpB.bssp"
#ERROR : Can't open dsspfile "1pg8A.bssp"
#ERROR : Can't open dsspfile "1gc0A.bssp"
#ERROR : Can't open dsspfile "1ukjA.bssp"
#ERROR : Can't open dsspfile "1gc0D.bssp"
#ERROR : Can't open dsspfile "1qgnA.bssp"
#ERROR : Can't open dsspfile "1pffA.bssp"
#ERROR : Can't open dsspfile "1i41A.bssp"
#ERROR : Can't open dsspfile "2rfvA.bssp"
#ERROR : Can't open dsspfile "1y4iA.bssp"
#ERROR : Can't open dsspfile "1gc0B.bssp"
#ERROR : Can't open dsspfile "1gc0C.bssp"
#ERROR : Can't open dsspfile "1gc2C.bssp"
#ERROR : Can't open dsspfile "1gc2B.bssp"
#ERROR : Can't open dsspfile "1gc2A.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"
#ERROR : Can't open dsspfile "2fq6B.bssp"
#ERROR : Can't open dsspfile "2fq6A.bssp"
#ERROR : Can't open dsspfile "2ctzA.bssp"
#ERROR : Can't open dsspfile "1cl1B.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"

## Summary of PDB Search
:364
    9e-66  39%  1ibjA  [c.67.1] CYSTATHIONINE BETA-LYASE
    1e-64  40%  1n8pA  [c.67.1] CYSTATHIONINE GAMMA-LYASE
    7e-63  40%  3e6gA  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    1e-62  40%  1cs1A  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    1e-60  38%  3cogD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-59  38%  2nmpD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-59  38%  2nmpC  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    1e-55  39%  2nmpB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    3e-55  42%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    4e-55  37%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    4e-55  37%  1e5eA  [c.67.1] METHIONINE GAMMA-LYASE
    7e-55  39%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    1e-54  42%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    2e-54  38%  2nmpA  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    2e-49  40%  3elpB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    2e-48  37%  1pg8A  [c.67.1] METHIONINE GAMMA-LYASE
    1e-46  40%  1gc0A  [c.67.1] METHIONINE GAMMA-LYASE
    2e-46  36%  1ukjA  [c.67.1] METHIONINE GAMMA-LYASE
    2e-46  41%  1gc0D  [c.67.1] METHIONINE GAMMA-LYASE
    4e-46  35%  1qgnA  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    4e-46  43%  1pffA  [c.67.1] METHIONINE GAMMA-LYASE
    4e-46  35%  1i41A  [c.67.1] CYSTATHIONINE GAMMA-SYNTHASE
    5e-46  34%  2rfvA  [x.x.x] METHIONINE GAMMA-LYASE
    6e-46  34%  1y4iA  [x.x.x] METHIONINE GAMMA-LYASE
    1e-45  40%  1gc0B  [c.67.1] METHIONINE GAMMA-LYASE
    1e-45  37%  1gc0C  [c.67.1] METHIONINE GAMMA-LYASE
    2e-44  41%  1gc2C  [c.67.1] METHIONINE GAMMA-LYASE
    2e-44  41%  1gc2B  [c.67.1] METHIONINE GAMMA-LYASE
    2e-44  41%  1gc2A  [c.67.1] METHIONINE GAMMA-LYASE
    5e-25  33%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
    7e-23  30%  2fq6B  [c.67.1 (1cl2B)] CYSTATHIONINE BETA-LYASE
    7e-23  30%  2fq6A  [c.67.1 (1cl2A)] CYSTATHIONINE BETA-LYASE
    5e-22  27%  2ctzA  [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
    7e-21  30%  1cl1B  [c.67.1] CYSTATHIONINE BETA-LYASE
    7e-21  30%  1cl1A  [c.67.1] CYSTATHIONINE BETA-LYASE
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxLHINTILAQAGIKSDEATGALVTPLHFSTTYQHPEFGRSTGFDYTRTKNPTRSKAEEVLATIESAD
1ibjA           ------VSTLLVNLDNKFDPFD-AMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKAD
1n8pA           ----------------------GSVIEPISLSTTFKQSSPANPIGYEYSRSQNPNRENLERAVAALENAQ
3e6gA           ----LSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQ-----------SSTHNPTRFAYERCVAALEGGT
1cs1A           --------TIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRXXXXXXXXX
3cogD           -----HFATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAK
2nmpD           -----HFATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAK
2nmpC           -----HFATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQ--GFEYSRSGNPTRNCLEKAVAALDGAK
2nmpB           -----HFATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAK
3e6gB           --------------------------------------------------THNPTRFAYERCVAALEGGT
1e5eB           ----------------------GAAIPPIYQTSTFVFDNCGQESGYIYTRLGNPTVSNLEGKIAFLEKTE
1e5eA           ----------------------GAAIPPIYQTSTFVFDNCGQESGYIYTRLGNPTVSNLEGKIAFLEKTE
3cogB           -----HFATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAK
3e6gD           --------------------------------------------------THNPTRFAYERCVAALEGGT
2nmpA           -----HFATQAIHVGQDPEQWTSAVVPPISLSTTFKQG--------------NPTRNCLEKAVAALDGAK
3elpB           ----------------------------------------------------NPTRNCLEKAVAALDGAK
1pg8A           --------------GYDPQDHGGALVPPVYQTATFTFPTVGEQAGHFYSRISNPTLNLLEARXXXXXXXX
1gc0A           ----------------------------------------------------------------------
1ukjA           --------------GYDPQDHGGALVPPVYQTATFTFPTVGEQAGHFYSRISNPTLNLLEARXXXXXXXX
1gc0D           ----------------------------------------------------------------------
1qgnA           ---------------------TDAITTPVFFNKTSELIDFKRRASFEYGRYGNPTTVVLEEKISALEGAE
1pffA           ----------------------------------------------------------------------
1i41A           ---------------------TDAITTPVFFNKTSELIDFKRRASFEYGRYGNPTTVVLEEKISALEGAE
2rfvA           -------NTQIVHAGQQPDPSTGALSTPIFQTSTFDSAEQGAARGYIYTRLGNPTTDALEKKLAVLERGE
1y4iA           -------NTQIVHAGQQPDPSTGALSTPIFQTSTFDSAEQGAASGYIYTRLGNPTTDALEKKLAVLERGE
1gc0B           ----------------------------------------------------------------------
1gc0C           --------------GYDPQDHGGALVPPVYQTATFTFP------------TSNPTLNLLEARXXXXXXXX
1gc2C           ----------------------------------------------------------------------
1gc2B           ----------------------------------------------------------------------
1gc2A           ----------------------------------------------------------------------
2cb1A           ----MEYTTLAVLAGLPEDPH-GAVGLPIYFKTLEEGQEFATGEGYVYARQKDPTAKALEEXXXXXXXXX
2fq6B           ----------------------------------------------------------ANSILAFIEQGD
2fq6A           ----------------------------------------------------------ANSILAFIEQGD
2ctzA           ----MRFETLQLHAGYEPEPTTLSRQVPIYPTTSYKSPEHAKEFGNIYSRIMNPTVDVLEKRXXXXXXXX
1cl1B           ----------------------------------------------------------ANSILAFIEQGD
1cl1A           ----------------------------------------------------------ANSILAFIEQGD


                         .         .         *         .         .         .         .:140
query           YALATSSGMSAIVLAFSGFPVGSKVLAVRDLYGGSFRWFNQVEQEGRFHFTYANTEEELIAELEKDVDVL
1ibjA           RAFCFTSGMAALSAVTHLIKNGEEIVAGDDVYGGSDRLLSQXXXXXXXXXXXXNTTDEVAAAIGPQTKLV
1n8pA           YGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGVETSFTNDLLNDLPQLIKETKLV
3e6gA           RAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAFSFVDLTDPAAFKAAIRADTKMV
1cs1A           XXVLTNTGMSAIHLVTTVFKPGDLLVAPHDCYGGSYRLFDSLAKRGRVLFVDQGDEQALRAALAEKPKLV
3cogD           YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEITPETKLV
2nmpD           YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEITPETKLV
2nmpC           YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEITPETKLV
2nmpB           YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEITPETKLV
3e6gB           RAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAFSFVDLTDPAAFKAAIRADTKMV
1e5eB           ACVATSSGMGAIAATLTILKAGDHLISDECLYGCTHALFEHALTKFGIQVDFINTAGEVKKHMKPNTKIV
1e5eA           ACVATSSGMGAIAATLTILKAGDHLISDECLYGCTHALFEHALTKFGIQVDFINTAGEVKKHMKPNTKIV
3cogB           YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEITPETKLV
3e6gD           RAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAFSFVDLTDPAAFKAAIRADTKMV
2nmpA           YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEITPETKLV
3elpB           YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEITPETKLV
1pg8A           XXXXXXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
1gc0A           ---------------------GDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
1ukjA           XXXXXXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
1gc0D           ---------------------GDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
1qgnA           STLLMASGMCATVMLLALVPAGGHIVTTTDCYRKTRIFIETILPKMGITATVIDPADVGALELQKKVNLF
1pffA           --------------------------------------------------------------LKPNTRIV
1i41A           STLLMASGMCATVMLLALVPAGGHIVTTTDCYRKTRIFIETILPKMGITATVIDPADVGALELQKKVNLF
2rfvA           AGLXXXXXXXXXXXXLLTLQQGDHIVSASAIYGCTHAFLSHSMPKFGINFVDAAKPEEIRAAMRPETKVV
1y4iA           AGLXXXXXXXXXXXXLLTLQQGDHIVSASAIYGCTHAFLSHSMPKFGINFVDAGKPEEIRAAMRPETKVV
1gc0B           ---------------------GDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
1gc0C           XXXXXXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
1gc2C           ---------------------GDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
1gc2B           ---------------------GDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
1gc2A           ---------------------GDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
2cb1A           XXXXXXXXXXXXXXXXXXXRPGDEVVAAKGLFGQTIGLFGQVLSLMGVTVRYVDPEPEAVRELSAKTRAV
2fq6B           HVLMTNTAYEP------SQDFCSKILSK---LGVTTSWFDPL------------IGADIVKHLQPNTKIV
2fq6A           HVLMTNTAYEP------SQDFCSKILSK---LGVTTSWFDPL------------IGADIVKHLQPNTKIV
2ctzA           XXXXXXSGXXXXXXXXXXXXXGDNIVSTPNLYGGTFNQFKVTLKRLGIEVRFTSREEEFLALTDEKTRAW
1cl1B           HVLMTNTAYEP------SQDFCSKILSK---LGVTTSWFDPL------------IGADIVKHLQPNTKIV
1cl1A           HVLMTNTAYEP------SQDFCSKILSK---LGVTTSWFDPL------------IGADIVKHLQPNTKIV


                         +         .         .         .         .         *         .:210
query           YIETPTNPLMLEFDIEXXXXXXXXXXXXXXXDNTFYSPIYQRPIEDGADIVLHSATKYLAGHNDVLAGVV
1ibjA           WLESPTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVL
1n8pA           WIETPTNPTLKVTDIQKVADLIKKHAAGQDVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVL
3e6gA           WIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIV
1cs1A           LVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCT-YLNGHSDVVAGVV
3cogD           WIETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
2nmpD           WIETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
2nmpC           WIETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
2nmpB           WIETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
3e6gB           WIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIV
1e5eB           YFETPANPTLKIIDMERVCKDAHSQEGVLVIDNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLI
1e5eA           YFETPANPTLKIIDMERVCKDAHSQEGVLVIDNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLI
3cogB           WIETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
3e6gD           WIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIV
2nmpA           WIETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
3elpB           WIETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
1pg8A           YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGIV
1gc0A           YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIV
1ukjA           YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIV
1gc0D           YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIV
1qgnA           FTESPTNPFLRCVDIELVSKLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFLGGHNDVLAG-C
1pffA           YFETPANPTLKVIDIEDAVKQARKQKDILVIDNTFASPILTNPLDLGVDIVVHSATKYINGHTDVVAGLV
1i41A           FTESPTNPFLRCVDIELVSKLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFLGGHNDVLAG-C
2rfvA           YIETPANPTLSLVDIETVAGIAHQQGALLVVDNTFMSPYCQQPLQLGADIVVHSVT-YXXXXXXXXXXXX
1y4iA           YIETPANPTLSLVDIETVAGIAHQQGALLVVDNTFMSPYCQQPLQLGADIVVHSVT-YXXXXXXXXXXXX
1gc0B           YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIV
1gc0C           YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIV
1gc2C           YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIV
1gc2B           YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIV
1gc2A           YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSAT-YLSGHGDITAGIV
2cb1A           FVETVANPALLVPDXXXXXXXXXXXXXXXXXDNTFGAAALCRPLAWGAHVVVESLT-WASGHGSVLGGAV
2fq6B           FLESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTA
2fq6A           FLESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTA
2ctzA           WVESIGNPALNIPDLEALAQAAREKGVALIVDNTFGMGGYLRPLAWGAALVTHSLTKWXGGRYPLLTGYH
1cl1B           FLESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAAT-YLVGHSDAMIGTA
1cl1A           FLESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAAT-YLVGHSDAMIGTA


                         .         .         .         +         .         .         .:280
query           VTNSLELYEKLFYNLNTTGAVLSPFDSYQLLRGLKTLSLRMERSTANAQEVVAFLKDSPAVKEVLYTGRG
1ibjA           AVKGEKLAKEVYFLQNSEGSGLAPFDCWLCLRGIKTMALRIEKQQENARKIAMYLSSHPRVKKVYYAGAG
1n8pA           ATNNKPLYERLQFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLADKENVVAVNYPGGG
3e6gA           VGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYSGFG
1cs1A           IAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHKGFG
3cogD           SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYTGCT
2nmpD           SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYTGCT
2nmpC           SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYTGCT
2nmpB           SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYTGCT
3e6gB           VGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYSGFG
1e5eB           CGKADLLQQIRMVGIDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGYG
1e5eA           CGKADLLQQIRMVGIDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGYG
3cogB           SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYTGCT
3e6gD           VGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYSGFG
2nmpA           SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYTGCT
3elpB           SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYTGCT
1pg8A           VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLG
1gc0A           VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPQPG
1ukjA           VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLG
1gc0D           VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGQG
1qgnA           ISGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYTGFG
1pffA           CSRADIIAKVKSQGIDITGAIISPHDAWLITRGTLTLDMRVKRAAENAQKVAEFLHEHKAVKKVYYPGLG
1i41A           ISGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYTGFG
2rfvA           XXKQEFIDQARFVGLDITGGCMSPFNAWLTLRGVKTLGIRMERHCENALKIARFLEGHPSITRVYYPGLG
1y4iA           XXKQEFIDQARFVGLDITGGCMSPFNAWLTLRGVKTLGIRMERHCENALKIARFLEGHPSITRVYYPGLG
1gc0B           VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQV-ELIHYPPG
1gc0C           VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLG
1gc2C           VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLG
1gc2B           VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLG
1gc2A           VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLG
2cb1A           LSRETELWRNYTLGLSLCGMALSPFNAYLLFQGLETVALRVARMSETARFLAERLQGHPKVKALRYPGGG
2fq6B           VCNA-RCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNFTGSS
2fq6A           VCNA-RCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNFTGSS
2ctzA           GLRLTEAFGELAFGLRDQGQALGPFEAWVVLLGMETLSLRAERHVENTLHLAHWLLEQPQVAWVNYPGLG
1cl1B           VCNA-RCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNFTGSS
1cl1A           VCNA-RCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNFTGSS


                         .         *         .         .         .         .         +:350
query           GMISFKVADETRIPHILNSLKVFSFAESLGGVESLITYPTTQTHADIPAEVRHSYGLTDDLLRLSIGIED
1ibjA           SVFSFITGSVALSKHLVETTKYFSIAVSFGSVKSLISMPCFMSHASIPAEVREARGLTEDLVRISAGIED
1n8pA           GMISFRIGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREASGVFDDLVRISVGIED
3e6gA           GIVSIVLKGGDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIED
1cs1A           AMLSFELGDEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHXXXXXXXXXXXGISETLLRISTGIED
3cogD           GMVTFYIKGTLQHAEILKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGXXX
2nmpD           GMVTFYIKGTLQHAEILKNLKLFTLAESLGGFESLAELPAIMTHAS--KNDRDVLGISDTLIRLSVGXXX
2nmpC           GMVTFYIKGTLQHAEILKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGXXX
2nmpB           GMVTFYIKGTLQHAEILKNLKLFTLAESLGGFESL---------AELPAII------SDTLIRLSVGXXX
3e6gB           GIVSIVLGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHEQL--------GISDALVRLSVGIED
1e5eB           SMITFILKSGFEAKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIED
1e5eA           SMITFILKSGFEAKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIED
3cogB           GMVTFYIKGTLQHAEILKNLKLFTLAESLGGFESLAELP------------------SDTLIRLSVGXXX
3e6gD           GIVSIVLGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMT--------REQLGISDALVRLSVGIED
2nmpA           GMVTFYIKGTLQHAEILKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGXXX
3elpB           GMVTFYIKGTLQHAEILKNLKLFTLAESLGGFESL---------AELPAIM---LGISDTLIRLSVGXXX
1pg8A           GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
1gc0A           GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
1ukjA           GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
1gc0D           GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
1qgnA           GAVSFEVGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVED
1pffA           SMIAFDVDGLEKAKKVLDNCHVVSLAVSLGGPESLIQHPASMTHAGVPKEEREAAGLTDNLIRLSVGCEN
1i41A           GAVSFEVGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVED
2rfvA           GIISFEIAGGLEAGRMINSVELCLLAVSLGDTETLIQHPASMTHSPVAPEERLKAGITDGLIRLSVGLED
1y4iA           GIISFEIAGGLEAGRMINSVELCLLAVSLGDTETLIQHPASMTHSPVAPEERLKAGITDGLIRLSVGLED
1gc0B           GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
1gc0C           GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
1gc2C           GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
1gc2B           GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
1gc2A           GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
2cb1A           PILTLDLGDLERASRFLGAIRLLK-AANLGDARTLLVHPWTTTHSRLKEEARLQAGVTPGLVRVSVG---
2fq6B           GLFSFKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGT--LIRLHIGLED
2fq6A           GLFSFKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGT--LIRLHIGLED
2ctzA           AVLTFGLGGYEAAKRFISRLKLISHLANVGDTRTLAIHPASTTHSQLSPEEQAQAGVSPEMVRLSVGLEH
1cl1B           GLFSFKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGT--LIRLHIGLED
1cl1A           GLFSFKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGT--LIRLHIGLED


                         .         .         .         .         *         .         .:420
query           ARDLIADLRQALEx
1ibjA           VDDLISDL------
1n8pA           TDDLLEDIKQALK-
3e6gA           LGDLRGDLERA---
1cs1A           GEDLIADL------
3cogD           XXXXXXXXXQALK-
2nmpD           XXXXXXXXXQALK-
2nmpC           XXXXXXXXXQALK-
2nmpB           XXXXXXXXXQALK-
3e6gB           LGDLRGDLERA---
1e5eB           ADELIADFKQGLD-
1e5eA           ADELIADFKQGLD-
3cogB           XXXXXXXXXQALK-
3e6gD           LGDLRGDLERA---
2nmpA           XXXXXXXXXQALK-
3elpB           XXXXXXXXXQALK-
1pg8A           IDDLLADVQQALK-
1gc0A           IDDLLADVQQALK-
1ukjA           IDDLLADVQQALK-
1gc0D           IDDLLADVQQALK-
1qgnA           FDDLKADILQALD-
1pffA           VQDIIDDLKQALD-
1i41A           FDDLKADILQALD-
2rfvA           PEDIINDLEHAI--
1y4iA           PEDIINDLEHAI--
1gc0B           IDDLLADVQQALK-
1gc0C           IDDLLADVQQALK-
1gc2C           IDDLLADVQQALK-
1gc2B           IDDLLADVQQALK-
1gc2A           IDDLLADVQQALK-
2cb1A           --------------
2fq6B           VDDLIADL------
2fq6A           VDDLIADL------
2ctzA           VEDLKAELKEAL--
1cl1B           VDDLIADL------
1cl1A           VDDLIADL------