[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56680.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2etdA.bssp"

## Summary of PDB Search
:186
    1e-14  42%  2etdA  [x.x.x] LEMA PROTEIN
:186

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVA
2etdA           ----------------------------QEVQEYSQIQNQLQRRADLIPNLVETV-GYAAHE-EILEEIA


                         .         .         *         .         .         .         .:140
query           ELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVV
2etdA           NARALIGA--TPQESAQXXXXXXXXXXXXXXXXENYPNL-ADANFRQL-DELAGTENRIAVARRDYNEAV


                         +         .         .         .         .         *         .:210
query           SNYNVKLExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2etdA           YNTAIGFE--------------------------------------