[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56707.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vbhA.bssp"
#ERROR : Can't open dsspfile "1vbgA.bssp"
#ERROR : Can't open dsspfile "2bg5A.bssp"

## Summary of PDB Search
:289
    3e-07  36%  1vbhA  [x.x.x] PYRUVATE,ORTHOPHOSPHATE DIKINASE
    3e-07  36%  1vbgA  [x.x.x] PYRUVATE,ORTHOPHOSPHATE DIKINASE
    9e-05  29%  2bg5A  [x.x.x] PHOSPHOENOLPYRUVATE-PROTEIN KINASE
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFVKDYLETICSLYSDEEVWYRFT
1vbhA           ----------------------------------------------------------------------
1vbgA           ----------------------------------------------------------------------
2bg5A           -----------------------------------------------FRTEFLYDRNSLPSEEEQFEAYK


                         .         .         *         .         .         .         .:140
query           ELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLK
1vbhA           --------------EKLSEVNPMLGFRGCRLGISYLTEMQARAIFEAAIAMTNQGVQVMVPLVGTPQELG
1vbgA           --------------EKLSEVNPMLGFRGCRLGISYLTEMQARAIFEAAIAMTNQGVQVMVPLVGTPQELG
2bg5A           EVVEKGGRPVTGDKEYLDKENPFLGYRAIRLCLDRPDIFKTQLRAILRA-SAYGNVQ-IYP-ISSVEEVR


                         +         .         .         .         .         *         .:210
query           QAITALRQYGFTGKVGTMIELPSAYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDLESPIMLDM
1vbhA           HQVTLIRQFANVGKVGTMIEIPRAALVADEIAEQA-EFFSFGTNDLTQMTFGYSRD--------------
1vbgA           HQVTLIRQFANVGKVGTMIEIPRAALVADEIAEQA-EFFSFGTNDLTQMTFGYSRD--------------
2bg5A           KANSILEEYDKEIKVG-IVEIPSAAVT-ADILAKEVDFFSIGTNDLTQYTLAVDRNEHVKEYYQPFHPAI


                         .         .         .         +         .         .         .:280
query           LRDMQDKARKNKINFAVAGYLNTSFIQKMNQLGIKCIIHYSSIPEIxxxxxxxxxxxxxxxxxxxxxxxx
1vbhA           ----------------------------------------------------------------------
1vbgA           ----------------------------------------------------------------------
2bg5A           LRLVKDAAHKEG-KFAACGEAGDPLAAVLLGLGLDEFSSATSIPEI------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
1vbhA           ---------
1vbgA           ---------
2bg5A           ---------