[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:ACF56712.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3f7jA.bssp"
#ERROR : Can't open dsspfile "3d3fA.bssp"
#ERROR : Can't open dsspfile "1vbjB.bssp"
#ERROR : Can't open dsspfile "1vbjA.bssp"
#ERROR : Can't open dsspfile "3b3dB.bssp"
#ERROR : Can't open dsspfile "3b3dA.bssp"
#ERROR : Can't open dsspfile "1vp5B.bssp"
#ERROR : Can't open dsspfile "1vp5A.bssp"
#ERROR : Can't open dsspfile "1mzrB.bssp"
#ERROR : Can't open dsspfile "1mzrA.bssp"
#ERROR : Can't open dsspfile "1a80A.bssp"
#ERROR : Can't open dsspfile "3h4gA.bssp"
#ERROR : Can't open dsspfile "3cv7A.bssp"
#ERROR : Can't open dsspfile "2ao0A.bssp"
#ERROR : Can't open dsspfile "1hqtA.bssp"
#ERROR : Can't open dsspfile "3h7rA.bssp"
#ERROR : Can't open dsspfile "1m9hA.bssp"
#ERROR : Can't open dsspfile "1zuaX.bssp"
#ERROR : Can't open dsspfile "1hw6A.bssp"
#ERROR : Can't open dsspfile "3h7uA.bssp"
#ERROR : Can't open dsspfile "2alrA.bssp"
#ERROR : Can't open dsspfile "1zgdA.bssp"
#ERROR : Can't open dsspfile "2bgsA.bssp"
#ERROR : Can't open dsspfile "2bgqA.bssp"
#ERROR : Can't open dsspfile "2pdbA.bssp"
#ERROR : Can't open dsspfile "2ipwA.bssp"
#ERROR : Can't open dsspfile "2is7A.bssp"
#ERROR : Can't open dsspfile "2pd5A.bssp"
#ERROR : Can't open dsspfile "2i16A.bssp"
#ERROR : Can't open dsspfile "1z8aA.bssp"
#ERROR : Can't open dsspfile "1us0A.bssp"
#ERROR : Can't open dsspfile "1pwmA.bssp"
#ERROR : Can't open dsspfile "2pdyA.bssp"
#ERROR : Can't open dsspfile "2pdxA.bssp"
#ERROR : Can't open dsspfile "2pdqA.bssp"
#ERROR : Can't open dsspfile "2pdmA.bssp"
#ERROR : Can't open dsspfile "2pdkA.bssp"
#ERROR : Can't open dsspfile "2pdiA.bssp"
#ERROR : Can't open dsspfile "2pdhA.bssp"
#ERROR : Can't open dsspfile "2pdfA.bssp"
#ERROR : Can't open dsspfile "2ikiA.bssp"
#ERROR : Can't open dsspfile "1el3A.bssp"
#ERROR : Can't open dsspfile "2dv0A.bssp"
#ERROR : Can't open dsspfile "1az1A.bssp"
#ERROR : Can't open dsspfile "2agtA.bssp"
#ERROR : Can't open dsspfile "1adsA.bssp"
#ERROR : Can't open dsspfile "2acsA.bssp"
#ERROR : Can't open dsspfile "1frbA.bssp"
#ERROR : Can't open dsspfile "2acuA.bssp"
#ERROR : Can't open dsspfile "1xgdA.bssp"
#ERROR : Can't open dsspfile "1ah3A.bssp"
#ERROR : Can't open dsspfile "1ah0A.bssp"
#ERROR : Can't open dsspfile "1q13B.bssp"
#ERROR : Can't open dsspfile "1c9wA.bssp"
#ERROR : Can't open dsspfile "1xjbB.bssp"
#ERROR : Can't open dsspfile "1xjbA.bssp"
#ERROR : Can't open dsspfile "1j96A.bssp"
#ERROR : Can't open dsspfile "1ihiA.bssp"
#ERROR : Can't open dsspfile "1q5mA.bssp"
#ERROR : Can't open dsspfile "1j96B.bssp"
#ERROR : Can't open dsspfile "1mrqA.bssp"
#ERROR : Can't open dsspfile "2ipjA.bssp"
#ERROR : Can't open dsspfile "3c3uA.bssp"
#ERROR : Can't open dsspfile "2fgbA.bssp"
#ERROR : Can't open dsspfile "2fvlA.bssp"
#ERROR : Can't open dsspfile "1xf0A.bssp"
#ERROR : Can't open dsspfile "1zq5A.bssp"
#ERROR : Can't open dsspfile "1s1rA.bssp"
#ERROR : Can't open dsspfile "1s1pA.bssp"
#ERROR : Can't open dsspfile "1ry0A.bssp"
#ERROR : Can't open dsspfile "2he5C.bssp"
#ERROR : Can't open dsspfile "2he8A.bssp"
#ERROR : Can't open dsspfile "2ipgA.bssp"
#ERROR : Can't open dsspfile "2p5nA.bssp"
#ERROR : Can't open dsspfile "2hejA.bssp"
#ERROR : Can't open dsspfile "2he8B.bssp"
#ERROR : Can't open dsspfile "3cv6A.bssp"
#ERROR : Can't open dsspfile "3caqB.bssp"
#ERROR : Can't open dsspfile "3burA.bssp"
#ERROR : Can't open dsspfile "1qwkA.bssp"
#ERROR : Can't open dsspfile "1jezB.bssp"
#ERROR : Can't open dsspfile "1k8cA.bssp"
#ERROR : Can't open dsspfile "1z9aA.bssp"
#ERROR : Can't open dsspfile "1mi3A.bssp"
#ERROR : Can't open dsspfile "1lwiA.bssp"
#ERROR : Can't open dsspfile "1ye4A.bssp"
#ERROR : Can't open dsspfile "1sm9A.bssp"
#ERROR : Can't open dsspfile "1jezA.bssp"
#ERROR : Can't open dsspfile "1ralA.bssp"
#ERROR : Can't open dsspfile "1afsA.bssp"
#ERROR : Can't open dsspfile "1r38A.bssp"
#ERROR : Can't open dsspfile "1pz1A.bssp"
#ERROR : Can't open dsspfile "3erpB.bssp"
#ERROR : Can't open dsspfile "1ynqA.bssp"
#ERROR : Can't open dsspfile "3erpA.bssp"
#ERROR : Can't open dsspfile "1ynpB.bssp"
#ERROR : Can't open dsspfile "1ynpA.bssp"
#ERROR : Can't open dsspfile "1og6C.bssp"
#ERROR : Can't open dsspfile "1og6A.bssp"
#ERROR : Can't open dsspfile "1ur3M.bssp"
#ERROR : Can't open dsspfile "1lqaA.bssp"
#ERROR : Can't open dsspfile "1og6B.bssp"
#ERROR : Can't open dsspfile "1pyfA.bssp"
#ERROR : Can't open dsspfile "1zsxA.bssp"
#ERROR : Can't open dsspfile "1qrqA.bssp"
#ERROR : Can't open dsspfile "1exbA.bssp"
#ERROR : Can't open dsspfile "3eauA.bssp"
#ERROR : Can't open dsspfile "3eb4A.bssp"
#ERROR : Can't open dsspfile "3eb3A.bssp"
#ERROR : Can't open dsspfile "1gveB.bssp"
#ERROR : Can't open dsspfile "2bp1B.bssp"
#ERROR : Can't open dsspfile "1gveA.bssp"
#ERROR : Can't open dsspfile "2clpI.bssp"
#ERROR : Can't open dsspfile "2clpA.bssp"
#ERROR : Can't open dsspfile "2bp1A.bssp"
#ERROR : Can't open dsspfile "2c91B.bssp"
#ERROR : Can't open dsspfile "2c91A.bssp"

## Summary of PDB Search
:280
    2e-76  54%  3f7jA  [x.x.x] YVGN PROTEIN
    2e-76  54%  3d3fA  [x.x.x] YVGN PROTEIN
    5e-73  51%  1vbjB  [x.x.x] PROSTAGLANDIN F SYNTHASE
    5e-73  51%  1vbjA  [x.x.x] PROSTAGLANDIN F SYNTHASE
    2e-60  45%  3b3dB  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    2e-60  45%  3b3dA  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    6e-60  49%  1vp5B  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
    6e-60  49%  1vp5A  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
    2e-56  46%  1mzrB  [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A
    2e-56  46%  1mzrA  [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A
    3e-51  41%  1a80A  [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    4e-51  41%  3h4gA  [x.x.x] ALCOHOL DEHYDROGENASE [NADP+]
    4e-51  41%  3cv7A  [x.x.x] ALCOHOL DEHYDROGENASE
    4e-51  41%  2ao0A  [x.x.x] ALDEHYDE DEHYDROGENASE
    8e-51  41%  1hqtA  [c.1.7] ALDEHYDE REDUCTASE
    5e-50  46%  3h7rA  [x.x.x] ALDO-KETO REDUCTASE
    2e-49  40%  1m9hA  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    4e-49  41%  1zuaX  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER B10
    1e-48  42%  1hw6A  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
    2e-48  42%  3h7uA  [x.x.x] ALDO-KETO REDUCTASE
    3e-47  40%  2alrA  [x.x.x] ALDEHYDE REDUCTASE
    1e-46  42%  1zgdA  [x.x.x] CHALCONE REDUCTASE
    6e-46  38%  2bgsA  [x.x.x] ALDOSE REDUCTASE
    3e-44  37%  2bgqA  [x.x.x] ALDOSE REDUCTASE
    1e-43  39%  2pdbA  [x.x.x] ALDOSE REDUCTASE
    4e-43  39%  2ipwA  [x.x.x] ALDOSE REDUCTASE
    6e-43  39%  2is7A  [x.x.x] ALDOSE REDUCTASE
    8e-43  39%  2pd5A  [x.x.x] ALDOSE REDUCTASE
    8e-43  38%  2i16A  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  1z8aA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  1us0A  [c.1.7] ALDOSE REDUCTASE
    1e-42  38%  1pwmA  [c.1.7] ALDOSE REDUCTASE
    1e-42  38%  2pdyA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  2pdxA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  2pdqA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  2pdmA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  2pdkA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  2pdiA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  2pdhA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  2pdfA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  2ikiA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  1el3A  [c.1.7] ALDOSE REDUCTASE
    1e-42  38%  2dv0A  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  1az1A  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  2agtA  [x.x.x] ALDOSE REDUCTASE
    1e-42  38%  1adsA  [c.1.7 (1ef3A)] ALDOSE REDUCTASE
    1e-42  38%  2acsA  [x.x.x] ALDOSE REDUCTASE
    4e-42  38%  1frbA  [x.x.x] FR-1 PROTEIN
    4e-42  38%  2acuA  [x.x.x] ALDOSE REDUCTASE
    5e-42  38%  1xgdA  [x.x.x] ALDOSE REDUCTASE
    6e-41  38%  1ah3A  [c.1.7 (1ekoA)] ALDOSE REDUCTASE
    6e-41  38%  1ah0A  [x.x.x] ALDOSE REDUCTASE
    2e-40  38%  1q13B  [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE
    2e-40  36%  1c9wA  [c.1.7] CHO REDUCTASE
    3e-40  40%  1xjbB  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
    3e-40  40%  1xjbA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
    3e-40  40%  1j96A  [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3
    3e-40  40%  1ihiA  [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-40  38%  1q5mA  [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE
    7e-40  40%  1j96B  [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3
    1e-39  40%  1mrqA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    1e-39  40%  2ipjA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
    1e-39  40%  3c3uA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    2e-39  38%  2fgbA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    7e-39  38%  2fvlA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C4
    1e-38  39%  1xf0A  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    2e-38  38%  1zq5A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    3e-38  38%  1s1rA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    3e-38  38%  1s1pA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    3e-38  38%  1ry0A  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    4e-38  39%  2he5C  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    5e-38  39%  2he8A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    3e-37  38%  2ipgA  [x.x.x] 3(17)ALPHA-HYDROXYSTEROID DEHYDROGENASE
    5e-37  38%  2p5nA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    5e-37  38%  2hejA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    5e-37  38%  2he8B  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    5e-37  38%  3cv6A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21
    5e-37  35%  3caqB  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    5e-37  35%  3burA  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    9e-37  37%  1qwkA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    2e-36  38%  1jezB  [c.1.7] XYLOSE REDUCTASE
    3e-36  39%  1k8cA  [c.1.7] XYLOSE REDUCTASE
    4e-36  39%  1z9aA  [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE
    4e-36  39%  1mi3A  [c.1.7] XYLOSE REDUCTASE
    8e-36  38%  1lwiA  [c.1.7] 3-ALPHA-HYDROXYSTEROID/DIHYDRODIOL DEHYDROGENASE
    1e-35  38%  1ye4A  [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE
    1e-35  38%  1sm9A  [c.1.7] XYLOSE REDUCTASE
    1e-35  38%  1jezA  [c.1.7] XYLOSE REDUCTASE
    4e-35  38%  1ralA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    4e-35  38%  1afsA  [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    6e-35  38%  1r38A  [c.1.7] XYLOSE REDUCTASE
    7e-18  35%  1pz1A  [c.1.7] GENERAL STRESS PROTEIN 69
    2e-17  33%  3erpB  [x.x.x] PUTATIVE OXIDOREDUCTASE
    4e-17  29%  1ynqA  [x.x.x] OXIDOREDUCTASE
    8e-17  33%  3erpA  [x.x.x] PUTATIVE OXIDOREDUCTASE
    3e-15  30%  1ynpB  [x.x.x] OXIDOREDUCTASE
    6e-15  30%  1ynpA  [x.x.x] OXIDOREDUCTASE
    2e-14  30%  1og6C  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    3e-14  32%  1og6A  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    4e-13  36%  1ur3M  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    2e-12  31%  1lqaA  [c.1.7] TAS PROTEIN
    5e-12  38%  1og6B  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    8e-12  30%  1pyfA  [c.1.7] IOLS PROTEIN
    5e-09  33%  1zsxA  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL BETA-2 SUBUNIT
    8e-09  33%  1qrqA  [c.1.7] PROTEIN (KV BETA2 PROTEIN)
    8e-09  33%  1exbA  [c.1.7] KV BETA2 PROTEIN
    8e-09  33%  3eauA  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    2e-08  33%  3eb4A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    5e-08  32%  3eb3A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    2e-07  28%  1gveB  [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE
    4e-07  28%  2bp1B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    7e-07  28%  1gveA  [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE
    4e-06  31%  2clpI  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    4e-06  31%  2clpA  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    8e-06  28%  2bp1A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    3e-05  28%  2c91B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    3e-05  28%  2c91A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
:280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDTYQLNNGVEIPVLGFGTFKAKDGEEAYRAVLEALKAGYRHIDTAAIYQNEESVGQAIKDSGVPREELF
3f7jA           -DTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREELF
3d3fA           -DTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREELF
1vbjB           ----KLSNGVMMPVLGFGMWKLQDGNEAETATMWAIKSGYRHIDTAAIYKNEESAGRAIASCGVPREELF
1vbjA           ----KLSNGVMMPVLGFGMWKLQDGNEAETATMWAIKSGYRHIDTAAIYKNEESAGRAIASCGVPREELF
3b3dB           -----LHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXXXXDLF
3b3dA           -----LHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXXXXDLF
1vp5B           -----LNNGVEMPILGYGVFQIPP-EKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKDEGVRREELF
1vp5A           -----LNNGVEMPILGYGVFQIPP-EKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKDEGVRREELF
1mzrB           ----KLQDGNVMPQLGLGVWQASN-EEVITAIQKALEVGYRSIDTAAAYKNEEGVGKALKNASVNREELF
1mzrA           ----KLQDGNVMPQLGLGVWQASN-EEVITAIQKALEVGYRSIDTAAAYKNEEGVGKALKNASVNREELF
1a80A           -----LNDGNSIPQLGYGVFKVPPAD-TQRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXXXRDDLF
3h4gA           -----LHTGQKMPLIGLGTWKSEPGQ-VKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETAVPREELF
3cv7A           -----LHTGQKMPLIGLGTWKSEPGQ-VKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETAVPREELF
2ao0A           -----LHTGQKMPLIGLGTWKSEPGQ-VKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETAVPREELF
1hqtA           -----LHTGQKMPLIGLGTWKSEPGQ-VKAAIKYALTVGYRHIDCAAIFGNELEIGEALQETAVPREELF
3h7rA           ---FELNTGAKLPCVGLGTYAM-----VATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKDGFVKREELF
1m9hA           -----LNDGNSIPQLGYGVYKVPPAD-TQRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXXXRDDLF
1zuaX           ----ELSTKAKMPIVGLGTWKSPLGK-VKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKAVKREDLF
1hw6A           -----LNDGNSIPQLGYGVFKVPPAD-TQRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXXXRDDLF
3h7uA           ---FKLNTGAKFPSVGLGTWQASPGLVG-DAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKDRVVKREDLF
2alrA           -----LHTGQKMPLIGLGTWKSEPGQ-VKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDAVPREELF
1zgdA           ---------LKMPVVGMGSFTCK--KDTKDAIIEAIKQGYRHFDTAAAYGSEQALGEALKEAIVTRDDLF
2bgsA           -DHFVLKSGHAMPAVGLGTWRA--GSDTAHSVRTAIEAGYRHVDTAAEYGVEKEVGKGLKEAGIDRKDLF
2bgqA           -DHFVLKSGHAMPAVGLGTW-----DTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLKEAGIDRKDLF
2pdbA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2ipwA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2is7A           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2pd5A           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHIYQNENEVGVAIREQVVKREELF
2i16A           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
1z8aA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
1us0A           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
1pwmA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2pdyA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2pdxA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2pdqA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2pdmA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2pdkA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2pdiA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2pdhA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2pdfA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2ikiA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
1el3A           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2dv0A           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
1az1A           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2agtA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
1adsA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
2acsA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
1frbA           ----ELSTKAKMPIVGLGTWKSPPNQ-VKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIKEKAVQREDLF
2acuA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVHQNENEVGVAIREQVVKREELF
1xgdA           -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
1ah3A           -----LYTGAKMPILGLGTWKSPPGKVT-EAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKVVKREDLF
1ah0A           -----LYTGAKMPILGLGTWKSPPGKVT-EAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKVVKREDLF
1q13B           -----LSDGHFIPVLGFGTYAPEEKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRDGTVKREDIF
1c9wA           ----ELSTKAKMPIVGLGTWQSPPGQ-VKEAVKVAIDAGYRHIDCAYAYYNEHEVGEAIKEKAVRREDLF
1xjbB           ----KLNDGHFMPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRDGSVKREDIF
1xjbA           ----KLNDGHFMPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRDGSVKREDIF
1j96A           ----KLNDGHFMPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRDGSVKREDIF
1ihiA           ----KLNDGHFMPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRDGSVKREDIF
1q5mA           -----LSDGHFIPVLGFGTYAPEEKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRDGTVKREDIF
1j96B           ----KLNDGHFMPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRDGSVKREDIF
1mrqA           ----KLNDGHFMPVLGFGTYAPAEKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
2ipjA           ----KLNDGHFMPVLGFGTAAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRDGSVKREDIF
3c3uA           ----KLNDGHFMPVLGFGTYAPAEKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
2fgbA           ----KLNDGHFMPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
2fvlA           ----ELNDGHFMPVLGFGTYAPPERNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRDGSVKREDIF
1xf0A           ----KLNDGHFMPVLGFGTY-APPESKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
1zq5A           ----KLNDGHFMPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
1s1rA           ----KLNDGHFMPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
1s1pA           ----KLNDGHFMPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
1ry0A           ----KLNDGHFMPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
2he5C           -----LNDGNFIPVLGFGTALPLECPKSKAKELTAIDAGFHHFDSASVYNTEDHVGEAIRDGTVRREDIF
2he8A           -----LNDGNFIPVLGFGTALPLECPKSKAKELTAIDAGFHHFDSASVYNTEDHVGEAIRDGTVRREDIF
2ipgA           -----LNDGNFIPVLGFGTALPLEASKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRDGTVRREDIF
2p5nA           -----LNDGNFIPVLGFGTALPLECPKSKAKELTAIDAGFHHFDSASVYNTEDHVGEAIRDGTVRREDIF
2hejA           -----LNDGNFIPVLGFGTALPLECPKSKAKELTAIDAGFHHFDSASVYNTEDHVGEAIRDGTVRREDIF
2he8B           -----LNDGNFIPVLGFGTALPLECPKSKAKELTAIDAGFHHFDSASVYNTEDHVGEAIRDGTVRREDIF
3cv6A           -----LNDGNFIPVLGFGTALPLECPKSKAKELTAIDAGFHHFDSASVYNTEDHVGEAIRDGTVRREDIF
3caqB           -----LSDGNSIPIIGLGTYKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKKVRREDIF
3burA           -----LSDGNSIPIIGLGTYKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKKVRREDIF
1qwkA           ----KLSNGVEMPVIGLGTWQSSPAE-VITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKEGVVKREELF
1jezB           ----KLSSGHLMPSIGFGCWKATAGEQVYQAI----KAGYRLFDGAEDYGNEKEVGDGVKDEGVKREEIF
1k8cA           ----KLSSGHLMPSIGFGCWKATAGEQVYQAI----KAGYRLFDGAEDYGNEKEVGDGVKDEGVKREEIF
1z9aA           ----KLSSGHLMPSIGFGCWKATAGEQVYQAI----KAGYRLFDGAEDYGNEKEVGDGVKDEGVKREEIF
1mi3A           ----KLSSGHLMPSIGFGCWKATAGEQVYQAI----KAGYRLFDGAEDYGNEKEVGDGVKDEGVKREEIF
1lwiA           -----LNDGNFIPVLGFGTVPAKD--EVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRDGTVKREDIF
1ye4A           ----KLSSGHLMPSIGFGCWKATAGEQVYQAI----KAGYRLFDGAEDYGNEKEVGDGVKDEGVKREEIF
1sm9A           ----KLSSGHLMPSIGFGCWKATAGEQVYQAI----KAGYRLFDGAEDYGNEKEVGDGVKDEGVKREEIF
1jezA           ----KLSSGHLMPSIGFGCWKATAGEQVYQAI----KAGYRLFDGAEDYGNEKEVGDGVKDEGVKREEIF
1ralA           -----LNDGNFIPVLGFGTTVAKD--EVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRDGTVKREDIF
1afsA           -----LNDGNFIPVLGFGTTVAKD--EVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRDGTVKREDIF
1r38A           ----KLSSGHLMPSIGFGCWKATAGEQVYQAI----KAGYRLFDGAEDYGNEKEVGDGVKDEGVKREEIF
1pz1A           -----------------------DEKTSIETIRAALDQGITLIDTAPAYQSEEIVGKAIKE--YKRDQVI
3erpB           -------SGVKLPAISLGNFGDTTRVENSRALLQAFDLGITHFDLANNYSAECNFGRILQEDFLPRDELI
1ynqA           ---------LHVSELGFGCMSGTDETKARRIMDEVLELGINYLDTADLYNNEQFVGKALKGR---RQDII
3erpA           -------SGVKLPAISLGNFGDTTRVENSRALLQAFDLGITHFDLANNYSAECNFGRILQEDFLPRDELI
1ynpB           ---------LHVSELGFGCMSGTDETKARRIMDEVLELGINYLDTADLYNNEQFVGKALKGR---RQDII
1ynpA           ---------LHVSELGFGCMSGTDETKARRIMDEVLELGINYLDTADLYNNEQFVGKALKGR---RQDII
1og6C           -----------------------------------------HADIYGGYQCEAAFGEALKLAPHLRERME
1og6A           -----------------------------------------HADIYGGYQCEAAFGEALKLAPHLRERME
1ur3M           -----------------------------------------HADIYGGYQCEAAFGEALKLAPHLREREI
1lqaA           ------HSSLEVSTLGLGTFGEQNSEADAHAQLDAVAQGINLIDVAEMYPTETYVGNWLAKHG-SREKLI
1og6B           -----------------------------------------HADIYGGYQCEAAFGEALKLAPHLRERME
1pyfA           ---------------GHNLYPNLNEETGKELVREAIRNGVT-LDTAYIYRSEELIGEVLREFN--REDVV
1zsxA           -------SGLRVSCLGLGTWVTFGGEMAEQLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
1qrqA           -------SGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
1exbA           -------SGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
3eauA           -------SGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
3eb4A           -------SGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
3eb3A           -------SGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
1gveB           -----------------------------------LQRGHTEIDTAFVYANGQSXXXXXXRSGCKVKIAT
2bp1B           -----------------------DAPASAAAVRAFLERGHTELDTAFMYSDSETIXXXXXXXXXCRVKIA
1gveA           -----------------------DVTSSSRSVRAFLQRGHTEIDTAFVYANGQSXXXXXXRSGCKVKIAT
2clpI           -----------------------------------LERGHTEIDTAFVYQSETIXXXXXXXXXXSDCRVK
2clpA           -----------------------------------LERGHTEIDTAFVYQSETIXXXXXXXXXXSDCRVK
2bp1A           -----------------------DAPASAAAVRAFLERGHTELDTAFMYSDGQSETIXXXXXXXXRVKIA
2c91B           -----------------------DASASAASVRAFLERGHSELDTAFMYQSENIXXXXXXXXXXXDCTVK
2c91A           -----------------------DASASAASVRAFLERGHSELDTAFMYQSENIXXXXXXXXXXXDCTVK


                         .         .         *         .         .         .         .:140
query           VTTKLWNSQQTYEQARQAFEESLEKLGLDYLDLYLIHWPNPKPLRENDQWKIRNAEVWRAMEDLYQEGKI
3f7jA           ITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPG------KDKYK----DTWRALEKLYKDGKI
3d3fA           ITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPG------KDKYK----DTWRALEKLYKDGKI
1vbjB           VTTKLWNSDQGYESTLSAFEKSIKKLGLEYVDLYLIHWPG----------KDKFIDTWKAFEKLYADKKV
1vbjA           VTTKLWNSDQGYESTLSAFEKSIKKLGLEYVDLYLIHWPG----------KDKFIDTWKAFEKLYADKKV
3b3dB           ITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKE----------AWRALETLYKEGRI
3b3dA           ITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKE----------AWRALETLYKEGRI
1vp5B           VTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGD---------VHCA--WKAMEEMYKDGLV
1vp5A           VTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGD---------VHCA--WKAMEEMYKDGLV
1mzrB           ITTKLWNDD--HKRPREALLDSLKKLQLDYIDLYLMHWPVP----AIDHY----VEAWKGMIELQKEGLI
1mzrA           ITTKLWNDD--HKRPREALLDSLKKLQLDYIDLYLMHWPVP----AIDHY----VEAWKGMIELQKEGLI
1a80A           ITTKLWNDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHWPTPAA----DNY----VHAWEKMIELRAAGLT
3h4gA           VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGDNPFPKNADGTIRYKDTWKALEALVAKGLV
3cv7A           VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGDNPFPKNADGTIRYKDTWKALEALVAKGLV
2ao0A           VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGDNPFPKNADGTIRYKDTWKALEALVAKGLV
1hqtA           VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGDNPFPKNADGTIRYKDTWKALEALVAKGLV
3h7rA           ITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPTPEMLTKPDI-----TSTWKAMEALYDSGKA
1m9hA           ITTKLWNDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHWPTPAA----DNY----VHAWEKMIELRAAGLT
1zuaX           IVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQPKDDKGNAGGKATFLDAWEAMEELVDEGLV
1hw6A           ITTKLWN-----DEPXXXXXXXXXXXXXDQVDLYLVHWPTPAA----DNY----VHAWEKMIELRAAGLT
3h7uA           ITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPGSVGIKPENLLPVDIPSTWKAMEALYDSGKA
2alrA           VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGDNPFPKNADGTIHYKETWKALEALVAKGLV
1zgdA           VTSKLWVTENHPHLVIPALQKSLKTLQLDYLDLYLIHWPLSSPIDVADLLPFDVKGVWESMEESLKLGLT
2bgsA           VTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWPAHMPPEAGEVLEFDMEGVWKEMENLVKDGLV
2bgqA           VTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWPAHMPPEAGEVLEFDMEGVWKEMENLVKDGLV
2pdbA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTPFPLDESGNVVPSDTNIWAAMEELVDEGLV
2ipwA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGKPGKEF--FPLDNVDTWAAMEELVDEGLV
2is7A           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGKPGKEFFPLDESNGVVWAAMEELVDEGLV
2pd5A           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2i16A           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
1z8aA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
1us0A           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
1pwmA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2pdyA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2pdxA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2pdqA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2pdmA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2pdkA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2pdiA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2pdhA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2pdfA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2ikiA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
1el3A           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2dv0A           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
1az1A           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2agtA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
1adsA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
2acsA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
1frbA           IVSKLWPTCFEKKLLKEAFQXXXXXXXXXXXXXXXIHWPQGQPGKEDDQGRILTSEAWEGMEELVDQGLV
2acuA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
1xgdA           IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
1ah3A           IVSKLWCTDHEKNLVKGACQTTXXXXXXXXXXXXXIHWPDPFPL-DGDGNVVPDVETWEAMEELVDEGLV
1ah0A           IVSKLWCTDHEKNLVKGACQTTXXXXXXXXXXXXXIHWPDPFPL-DGDGNVVPDVETWEAMEELVDEGLV
1q13B           YTSKLWCTFHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTALPTDEHGKAIFDTVDIWEAMEKCKDAGLA
1c9wA           IVSKLWPTCFERKLLKEAFQXXXXXXXXXXXXXXXIHWPQGQPGKEDDQGNVLTSKIWEVMEELVDEGLV
1xjbB           YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPSVKPIPKDENGKILFDTVWEAMEKCKDAGLA
1xjbA           YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPSVKPIPKDENGKILFDTVWEAMEKCKDAGLA
1j96A           YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPSVKPIPKDENGKILFDTVWEAMEKCKDAGLA
1ihiA           YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPSVKPIPKDENGKILFDTVWEAMEKCKDAGLA
1q5mA           YTSKLWCTFHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTALPTDEHGKAIFDTVDIWEAMEKCKDAGLA
1j96B           YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKILFDTVWEAMEKCKDAGLA
1mrqA           YTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPSVKPIPKDENGKILFDTVWEAVEKCKDAGLA
2ipjA           YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPSVKPIPKDENGKILFDTVWEAMEKCKDAGLA
3c3uA           YTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPSVKPIPKDENGKILFDTVWEAVEKCKDAGLA
2fgbA           YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIH--SPMSLKPGEIFDIVDCTTWEAMEKCKDAGLA
2fvlA           YTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPTPLPKDENGKVIFDTVDLWEVMEKCKDAGLA
1xf0A           YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVWEAMEKCKDAGLA
1zq5A           YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIH--SPMSLKPGEELSVDLCTTWEAMEKCKDAGLA
1s1rA           YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVWEAMEKCKDAGLA
1s1pA           YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVWEAMEKCKDAGLA
1ry0A           YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVWEAMEKCKDAGLA
2he5C           YTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAKPGEENDEHRVDLCATWEAMEKCKDAGLT
2he8A           YTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAKPGEENDEHRVDLCATWEAMEKCKDAGLT
2ipgA           YTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAKPGEENDEHRVDLCATWEAMEKCKDAGLT
2p5nA           YTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAKPGEENDEHRVDLCATWEAMEKCKDAGLT
2hejA           YTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAKPGEENDEHRVDLCATWEAMEKCKDAGLT
2he8B           YTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAKPGEENDEHRVDLCATWEAMEKCKDAGLT
3cv6A           YTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAKPGEENDEHRVDLCATWEAMEKCKDAGLT
3caqB           YCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPEIYPRDENGKWKSNLCATWEAMEACKDAGLV
3burA           YCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPEIYPRDENGKWKSNLCATWEAMEACKDAGLV
1qwkA           ITTKAWTHELAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFNDDMSEHIASPVEDVWRQFDAVYKAGLA
1jezB           LTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPKFVPIEENFVYEVPILETWKALEKLVAAGKI
1k8cA           LTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPKFVPIEENFVYEVPILETWKALEKLVAAGKI
1z9aA           LTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPKFVPIEENFVYEVPILETWKALEKLVAAGKI
1mi3A           LTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPKFVPIEENFVYEVPILETWKALEKLVAAGKI
1lwiA           YTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALPRDEHGKLLFETVDIWEAMEKCKDAGLA
1ye4A           LTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPKFVPIEENFVYEVPILETWKALEKLVAAGKI
1sm9A           LTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPKFVPIEENFVYEVPILETWKALEKLVAAGKI
1jezA           LTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPKFVPIEENFVYEVPILETWKALEKLVAAGKI
1ralA           YTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALPRDEHGKLLFETVDIWEAMEKCKDAGLA
1afsA           YTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALPRDEHGKLLFETVDIWEAMEKCKDAGLA
1r38A           LTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIAFPKFVPIEENFVYEVPILETWKALEKLVAAGKI
1pz1A           LATKTWKNNQLFRHANRAVENSLKRLQTDYIDLYQVHWPDPVPIEE-------TAEV----KELYDAGKI
3erpB           ISTKMWDGPYGDWGSRKSLDQSLKRMGLEYVDIFYHHRPDPEPLK----------ETMKALDHLVRHGKA
1ynqA           LATKVWWWDPSKAYIKEAVKDSLRRLQTDYIDLYQLHGGTDDPIDETIE----------AFEELKQEGVI
3erpA           ISTKMWDGPYGDWGSRKSLDQSLKRMGLEYVDIFYHHRPDPEPLK----------ETMKALDHLVRHGKA
1ynpB           LATKVWDPSKAY--IKEAVKDSLRRLQTDYIDLYQLHGGTDDPIDETIE----------AFEELKQEGVI
1ynpA           LATKVSKAY-----IKEAVKDSLRRLQTDYIDLYQLHGGTDDPIDETIE----------AFEELKQEGVI
1og6C           IVSKCGIATTAREEIIKSAEQSLINLATDHLDLLLIH--RPDPLMDAD-------EVADAFKHLHQSGKV
1og6A           IVSKCGIATTAREEIIKSAEQSLINLATDHLDLLLIH--RPDPLMDAD-------EVADAFKHLHQSGKV
1ur3M           VTAREENVIGHYITDRKSAEQSLINLATDHLDLLLIHRPDP----------LDADEVADAFKHLHQSGKV
1lqaA           IASKVSGPSRNNDKGREALHDSLKRLQTDYLDLYQVHWPQ-RPTKLGYSWAVSLLDTLDALAEYQRAGKI
1og6B           IVSKCGIATTAREEIIKSAEQSLINLATDHLDLLLIH--RPDPLMDAD-------EVADAFKHLHQSGKV
1pyfA           IATKAAHRKQSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKD---------EAVNALNE-KKAGKI
1zsxA           ITTKIWGGKAETERGLEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
1qrqA           ITTKIWGGKAETERGLEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
1exbA           ITTKIWGGKAETERGLEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
3eauA           ITTKIWGGKAETERGLEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
3eb4A           ITTKIWGGKAETERGLEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
3eb3A           ITTKIFAGGKAETERGEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
1gveB           KAAPMFGKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPDHTPIEETLQ----------ACHQLHQEGKF
2bp1B           TKANPWDGKSLKDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVE---------ETLHACQRLHQEGKF
1gveA           KAAPMFGKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPHGTPIEETLQ----------ACHQLHQEGKF
2clpI           IDTKLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVE---------ETLRACHQLHQEGKF
2clpA           IDTKLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVE---------ETLRACHQLHQEGKF
2bp1A           TKANPWDGKSLKDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVE---------ETLHACQRLHQEGKF
2c91B           IATKAWEGKSLKDSIRSQLETSLKRLQCPRVDLFYLHAPDHSTPVE---------ETLCACHQLHQEGKF
2c91A           IATKAWEGKSLKDSIRSQLETSLKRLQCPRVDLFYLHAPDHSTPVE---------ETLCACHQLHQEGKF


                         +         .         .         .         .         *         .:210
query           RAIGVSNFLPHHLDALLETAKILPAVNQVRLAPGVYQDQVVAYCREKGILLEAWGPFGQGELFDSKQVQE
3f7jA           RAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQGQLLDNEVLTQ
3d3fA           RAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQGQLLDNEVLTQ
1vbjB           RAIGVSNFHEHHIEELLKHCKVAPMVNQIELHPLLNQKALCEYCKSKNIAVTAWSPLGQGHLVEDARLKA
1vbjA           RAIGVSNFHEHHIEELLKHCKVAPMVNQIELHPLLNQKALCEYCKSKNIAVTAWSPLGQGHLVEDARLKA
3b3dB           KAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLAD
3b3dA           KAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLAD
1vp5B           RAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGNIFQNGVLRS
1vp5A           RAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGNIFQNGVLRS
1mzrB           KSIGVCNFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGVFDQKVIRD
1mzrA           KSIGVCNFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGVFDQKVIRD
1a80A           RSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGDLFGAEPVTX
3h4gA           RALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDLLEEPVVQA
3cv7A           RALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDLLEEPVVQA
2ao0A           RALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDLLEEPVVQA
1hqtA           RALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDLLEEPVVQA
3h7rA           RAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLSGYSPLGKGEVLQNPIVTE
1m9hA           RSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGDLFGAEPVTX
1zuaX           KALGVSNFSHFQIEKLLNKLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDLLEDPKIKE
1hw6A           RSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGDLFGAEPVTX
3h7uA           RAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVHLSAYSPLGKSDVLKNPILNM
2alrA           QALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYS--XXXXXXXXXXXXX
1zgdA           KAIGVSNFSVKKLENLLSVATVLPAVNQVEMNLAWQQKKLREFCNAHGIVLTAFSPVGPNEVMENDMLKE
2bgsA           KDIGVCNYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGSSELAHDPVVEK
2bgqA           KDIGVCNYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGK-NLAHDPVVEK
2pdbA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2ipwA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2is7A           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2pd5A           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2i16A           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
1z8aA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
1us0A           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
1pwmA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2pdyA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2pdxA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2pdqA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2pdmA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2pdkA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2pdiA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2pdhA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2pdfA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2ikiA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
1el3A           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2dv0A           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
1az1A           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2agtA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
1adsA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
2acsA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
1frbA           KALGVSNFNHFQIERLLNKPKHKPVTNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDLLEDPKIKE
2acuA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
1xgdA           KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
1ah3A           KAIGVSNFNHLQVEKILNKPKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDLLEDPRIKA
1ah0A           KAIGVSNFNHLQVEKILNKPKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDLLEDPRIKA
1q13B           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHRLLEDPLIGA
1c9wA           KALGVSNFNHFQIERILNKPKHKPVTNQVECHPYLTQEKLIEYCHSKGITVTAYSPLGSPNLLEDPKIKE
1xjbB           KSIGVSNFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
1xjbA           KSIGVSNFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
1j96A           KSIGVSNFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
1ihiA           KSIGVSNFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
1q5mA           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHRLLEDPLIGA
1j96B           KSIGVSNFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
1mrqA           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
2ipjA           KSIGVSNFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
3c3uA           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
2fgbA           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRLLEDPVLCA
2fvlA           KSIGVSNFNYRQLEMILNKLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRLLEDPVLCA
1xf0A           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRLLEDPVLCA
1zq5A           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRLLEDPVLCA
1s1rA           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRLLEDPVLCA
1s1pA           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRLLEDPVLCA
1ry0A           KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRLLEDPVLCA
2he5C           KSIGVSNFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTGVLLDEPVLGS
2he8A           KSIGVSNFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTGVLLDEPVLGS
2ipgA           KSIGVSNFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRLLDEPVLGS
2p5nA           KSIGVSNFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRLLDEPVLGS
2hejA           KSIGVSNFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRLLDEPVLGS
2he8B           KSIGVSNFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRLLDEPVLGS
3cv6A           KSIGVSNFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRLLDEPVLGS
3caqB           KSLGVSNFNRRQLELILNKLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRLLKDALLNS
3burA           KSLGVSNFNRRQLELILNKLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRLLKDALLNS
1qwkA           KAVGVSNWNNDQISRALALGLTPVHNSQVELHLYFPQHDHVDFCKKHNISVTSYATLGSGQKLDDQNVLA
1jezB           KSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSF----LFAHDTIKA
1k8cA           KSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGQGRLFAHDTIKA
1z9aA           KSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGQGRLFAHDTIKA
1mi3A           KSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGQGRLFAHDTIKA
1lwiA           KSIGVSNFNCRQLERILNKLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSKTWVDQKSLCA
1ye4A           KSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGQGRLFAHDTIKA
1sm9A           KSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGQGRLFAHDTIKA
1jezA           KSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAY-----STLFAHDTIKA
1ralA           KSIGVSNFNCRQLERILNKLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRLLDDPVLCA
1afsA           KSIGVSNFNCRQLERILNKLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRLLDDPVLCA
1r38A           KSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGQGRLFAHDTIKA
1pz1A           RAIGVSNFSIEQ-----DTFRAVAPLHTIQPPYNLFEESVLPYAKDNKITTLLYGSLCRGLLHDPKQLDK
3erpB           LYVGISNYLARQAIDILEDLGTPCLIHQPKLFERWVEDGLLALLQEKGVGSIAFSPLAGGQLTDRRRLNE
1ynqA           RYYGISSIRPNVIKEYLKRSNIVSIMMQYSILPLIQEHGVSVVVRARGLLSRRPLPEGEGYLYDELKLLR
3erpA           LYVGISNYLARQAIDILEDLGTPCLIHQPKLFERWVEDGLLALLQEKGVGSIAFSPLAGGQLTDRRRLNE
1ynpB           RYYGISSIRPNVIKEYLKRSNIVSIMMQYSILPLIQEHGVSVVVRARGLLSRRPLPEGEGYLYDELKLLR
1ynpA           RYYGISSIRPNVIKEYLKRSNIVSIMMQYSILPLIQEHGVSVVVRARGLLSRRPLPEGEGYLYDELKLLR
1og6C           RHFGVSNFTPAQFALLQSRLPFTLATNQVEISPXXXXXXXXXXXXXXRVRPMAWSCLGGGRLFNDDYFQP
1og6A           RHFGVSNFTPAQFALLQSRLPFTLATNQVEISPXXXXXXXXXXXXXXRVRPMAWSCLGGGRLFNDDYFQP
1ur3M           RHFGVSNFTPAQFALLQSRLPFTLATNQVEISPXXXXXXXXXXXXXXXRVRPAWSCLGGGRLFNDDYFQP
1lqaA           RYIGVSNETAFHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLYSGEQTQD
1og6B           RHFGVSNFTPAQFALLQSRLPFTLATNQVEISP-------------------------------------
1pyfA           RSIGVSNFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPFPEGDLFKGERFKE
1zsxA           MYWGTSRW------SSMEIMEAYSVARQFNLTPPIEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
1qrqA           MYWGTSRW------SSMEIMEAYSVARQFNLIPPIEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
1exbA           MYWGTSRW------SSMEIMEAYSVARQFNLIPPIEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
3eauA           MYWGTSRW------SSMEIMEAYSVARQFNLIPPIEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
3eb4A           MYWGTSRW------SSMEIMEAYSVARQFNLPPRCEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
3eb3A           MYWGTSRW------SSMEIMEAYSVARQFNLIPPIEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
1gveB           VELGLSNYVSWEVAEICTLCKIMPTVYQ-----GMYETELFPCLRHFGLRFYAFNPLAGGLLTGRYKYQD
2bp1B           VELGLSNYASWEVAEICTLCKILPTVYQ-----GMYETELFPCLRHFGLRFYAYNPLAGGLL--------
1gveA           VELGLSNYVSWEVAEICTLCKIMPTVYQ-----GMYETELFPCLRHFGLRFYAFNPLAGGLLTGRYKYQD
2clpI           VELGLSNYAAWEVAEICTLCKILPTVYQ-----GMYETELFPCLRHFGLRFYAFNPLAGGLL--------
2clpA           VELGLSNYAAWEVAEICTLCKILPTVYQ-----GMYETELFPCLRHFGLRFYAFNPLAGGLL--------
2bp1A           VELGLSNYASWEVAEICTLCKILPTVYQ-----GMYETELFPCLRHFGLRFYAYNPLAGGLL--------
2c91B           VELGLSNYASWEVAEICTLCKILPTVYQ-----GMYEAELLPCLRHFGLRFYAYNPLAGGLL--------
2c91A           VELGLSNYASWEVAEICTLCKILPTVYQ-----GMYEAELLPCLRHFGLRFYAYNPLAGGLL--------


                         .         .         .         +         .         .         .:280
query           IAANHGKSIAQIALAWSLAEGFLPLPKSVTTSRIQANLDCFGIELSHEERETLKTIAVQSGAPRVDDVDF
3f7jA           IAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDAL--------------
3d3fA           IAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDAL--------------
1vbjB           IGGKYGKTAAQVMLRWEIQAGVITIPKSGNEARIKENGNIFDFELTAEDIQVI-----------------
1vbjA           IGGKYGKTAAQVMLRWEIQAGVITIPKSGNEARIKENGNIFDFELTAEDIQVI-----------------
3b3dB           IAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNENRVGPDPDNFDF
3b3dA           IAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNENRVGPDPDNFDF
1vp5B           IAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATL--------------
1vp5A           IAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATL--------------
1mzrB           LADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDE---------------------
1mzrA           LADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDE---------------------
1a80A           XXXXHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGDGSGRVDEVD-
3h4gA           LAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDAL--------------
3cv7A           LAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDAL--------------
2ao0A           LAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDAL--------------
1hqtA           LAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDAL--------------
3h7rA           VAEKLGKTTAQVALRWGLQTGHSVLPKSSSGARLKENLDVF-----------------------------
1m9hA           XXXXHGKTPAQAVLRWHLQKGFVVFPGSVRREHLEENLDVFDFDLTDTEIAAIDAMDPGDGSGRVDEVD-
1zuaX           IAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATI-----------------
1hw6A           XXXXHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTE---------------------
3h7uA           VAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGRIKENFNVF-----------------------------
2alrA           XXXKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNAL--------------
1zgdA           IADAHGKSVAQISLRWLYEQGVTFVPKSYDKERMNQNLRIFDWSLTKEDHEKIAQI--------------
2bgsA           VANKLNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSI--------------
2bgqA           VANKLNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSI--------------
2pdbA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2ipwA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2is7A           IAAKHDKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2pd5A           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2i16A           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
1z8aA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
1us0A           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
1pwmA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2pdyA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2pdxA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2pdqA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2pdmA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2pdkA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2pdiA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2pdhA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2pdfA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2ikiA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
1el3A           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2dv0A           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
1az1A           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2agtA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
1adsA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
2acsA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
1frbA           IAAKHEKTSAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATI-----------------
2acuA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
1xgdA           IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPEAIAENFKVFDFELSSQDMTTL-----------------
1ah3A           IAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTL-----------------
1ah0A           IAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTL-----------------
1q13B           LAKKHQQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSL--------------
1c9wA           IAAKHKKTSAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATI-----------------
1xjbB           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
1xjbA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
1j96A           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
1ihiA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
1q5mA           LAKKHQQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSL--------------
1j96B           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
1mrqA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
2ipjA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
3c3uA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
2fgbA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAI-----------------
2fvlA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVL-----------------
1xf0A           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAI-----------------
1zq5A           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAI-----------------
1s1rA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAI-----------------
1s1pA           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAI-----------------
1ry0A           LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAI-----------------
2he5C           MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVL-----------------
2he8A           MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVL-----------------
2ipgA           MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVL-----------------
2p5nA           MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVL-----------------
2hejA           MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVL-----------------
2he8B           MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVL-----------------
3cv6A           MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVL-----------------
3caqB           LGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEAL--------------
3burA           LGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEAL--------------
1qwkA           LAEKTHKTPAQVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEED---------------------
1jezB           IAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI------------
1k8cA           IAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI------------
1z9aA           IAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI------------
1mi3A           IAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI------------
1lwiA           IAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKAL-----------------
1ye4A           IAAKYNKTPAEVLLRWAAQRGIAVIPRSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI------------
1sm9A           IAAKYNKTPAEVLLRWAAQRGIAVIPRSDLPERLVQNRSFNTFDLTKEDFEEIAKLDI------------
1jezA           IAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI------------
1ralA           IAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKAL-----------------
1afsA           IAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKAL-----------------
1r38A           IAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI------------
1pz1A           LATRYGKSVIHLAVRWILDQADIALWGARKPGQLEALSEITGWTLNSEDQKDINTI--------------
3erpB           LAARRGQKLSQMALAWVL----------------------------------------------------
1ynqA           ESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVELTAEERQHIQKLA-------------
3erpA           LAARRGQKLSQMALAWVL----------------------------------------------------
1ynpB           ESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVELTAEERQHIQKLA-------------
1ynpA           ESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVELTAEERQHIQKLA-------------
1og6C           LRDENAGSIEQVVNAWVLRLPSQPLPGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGYDVP-------
1og6A           LRDENAGSIEQVVNAWVLRLPSQPLPGSGKIERVRAAVEAETLKMTRQQ---------------------
1ur3M           LRDENAGSIEQVVNAWVLRLPSQPLPGSGKIERVRAAV----------EAETLKT---------------
1lqaA           IARRHGLDPAQMALAFVRRQPFVTLLGATTMDQLKTNIESLHLELSED----------------------
1og6B           ----------------------------------------------------------------------
1pyfA           IAEKHNVDIPHIVLAWYLAEIDILIPGAKRADQLIDNIKTADVTLSQED---------------------
1zsxA           IAERLGCTLPQLAIAWCL----------------------------------------------------
1qrqA           IAERLGCTLPQLAIAWCL----------------------------------------------------
1exbA           IAERLGCTLPQLAIAWCL----------------------------------------------------
3eauA           IAERLGCTLPQLAIAWCL----------------------------------------------------
3eb4A           IAERLGCTLPQLAIAWCL----------------------------------------------------
3eb3A           IAERLGCTLPQLAIAWCL----------------------------------------------------
1gveB           WKEEHFNGIALVEKALKTTYG-------------------------------------------------
2bp1B           ----------------------------------------------------------------------
1gveA           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
2bp1A           ----------------------------------------------------------------------
2c91B           ----------------------------------------------------------------------
2c91A           ----------------------------------------------------------------------