[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for spne4:argR1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f9nB.bssp"
#ERROR : Can't open dsspfile "1f9nC.bssp"
#ERROR : Can't open dsspfile "1f9nD.bssp"
#ERROR : Can't open dsspfile "1f9nA.bssp"
#ERROR : Can't open dsspfile "1b4aA.bssp"
#ERROR : Can't open dsspfile "3fhzD.bssp"
#ERROR : Can't open dsspfile "3fhzC.bssp"
#ERROR : Can't open dsspfile "3fhzB.bssp"
#ERROR : Can't open dsspfile "3fhzA.bssp"
#ERROR : Can't open dsspfile "3ereD.bssp"
#ERROR : Can't open dsspfile "2p5mB.bssp"
#ERROR : Can't open dsspfile "2p5mA.bssp"
#ERROR : Can't open dsspfile "2p5lD.bssp"
#ERROR : Can't open dsspfile "2p5kA.bssp"
#ERROR : Can't open dsspfile "1b4bA.bssp"
#ERROR : Can't open dsspfile "2zfzF.bssp"
#ERROR : Can't open dsspfile "2zfzD.bssp"
#ERROR : Can't open dsspfile "2zfzB.bssp"
#ERROR : Can't open dsspfile "2zfzA.bssp"

## Summary of PDB Search
:156
    1e-23  40%  1f9nB  [a.4.5 - d.74.2] ARGININE REPRESSOR/ACTIVATOR PROTEIN
    5e-23  39%  1f9nC  [a.4.5 - d.74.2] ARGININE REPRESSOR/ACTIVATOR PROTEIN
    7e-23  39%  1f9nD  [a.4.5 - d.74.2] ARGININE REPRESSOR/ACTIVATOR PROTEIN
    7e-23  39%  1f9nA  [a.4.5 - d.74.2] ARGININE REPRESSOR/ACTIVATOR PROTEIN
    1e-20  37%  1b4aA  [a.4.5 - d.74.2] ARGININE REPRESSOR
    9e-13  31%  3fhzD  [x.x.x] ARGININE REPRESSOR
    9e-13  31%  3fhzC  [x.x.x] ARGININE REPRESSOR
    9e-13  31%  3fhzB  [x.x.x] ARGININE REPRESSOR
    9e-13  31%  3fhzA  [x.x.x] ARGININE REPRESSOR
    9e-13  31%  3ereD  [x.x.x] ARGININE REPRESSOR
    1e-10  35%  2p5mB  [x.x.x] ARGININE REPRESSOR
    1e-10  35%  2p5mA  [x.x.x] ARGININE REPRESSOR
    1e-10  50%  2p5lD  [x.x.x] ARGININE REPRESSOR
    5e-10  49%  2p5kA  [x.x.x] ARGININE REPRESSOR
    1e-09  34%  1b4bA  [d.74.2] ARGININE REPRESSOR
    9e-05  33%  2zfzF  [x.x.x] ARGININE REPRESSOR
    9e-05  33%  2zfzD  [x.x.x] ARGININE REPRESSOR
    9e-05  33%  2zfzB  [x.x.x] ARGININE REPRESSOR
    9e-05  33%  2zfzA  [x.x.x] ARGININE REPRESSOR
:156

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKSEHRHQLIRALITKNKIHTQAELQALLAKNDIQVTQATLSRDIKNMNLSKVREEDSAYYVLNNGSIS
1f9nB           MNKGQ-RHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYYSLPADQRF
1f9nC           -NKGQ-RHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYYSLPADQRF
1f9nD           ------RHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYYSLPADQRF
1f9nA           ------RHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYYSLPADQRF
1b4aA           ------RHIKIREIIMSNDIETQDELVDRLREAGFNVTQATVSRDIKEMQLVKVPMANGRYYSLPSDQRF
3fhzD           ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
3fhzC           ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
3fhzB           ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
3fhzA           ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
3ereD           ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
2p5mB           ----------------------------------------------------------------------
2p5mA           ----------------------------------------------------------------------
2p5lD           MNKGQ-RHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSY---------
2p5kA           -NKGQ-RHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSY---------
1b4bA           ----------------------------------------------------------------------
2zfzF           ----------------------------------------------------------------------
2zfzD           ----------------------------------------------------------------------
2zfzB           ----------------------------------------------------------------------
2zfzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KWEKRLELYMEDALVWMRPVQHQVLLKTLPGLAQSFGSIIDTLSFPDAIATLCGNDVCLIICEDADTAQK
1f9nB           NPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTE-
1f9nC           NPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTE-
1f9nD           NPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTE-
1f9nA           NPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTE-
1b4aA           NPLQKLKRALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKK
3fhzD           GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
3fhzC           GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
3fhzB           GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
3fhzA           GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
3ereD           GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
2p5mB           ----KLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTE-
2p5mA           ----KLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTE-
2p5lD           ----------------------------------------------------------------------
2p5kA           ----------------------------------------------------------------------
1b4bA           -----------DVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKK
2zfzF           ------------------------VLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
2zfzD           ------------------------VLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
2zfzB           ------------------------VLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
2zfzA           ------------------------VLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ


                         +         .         .         .         .         *         .:210
query           CFEELKxxxxxxxxxx
1f9nB           ----------------
1f9nC           ----------------
1f9nD           ----------------
1f9nA           ----------------
1b4aA           VSNQL-----------
3fhzD           MFENLR----------
3fhzC           MFENLR----------
3fhzB           MFENLR----------
3fhzA           MFENLR----------
3ereD           MFENLR----------
2p5mB           ----------------
2p5mA           ----------------
2p5lD           ----------------
2p5kA           ----------------
1b4bA           VSNQL-----------
2zfzF           MFENLR----------
2zfzD           MFENLR----------
2zfzB           MFENLR----------
2zfzA           MFENLR----------