[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF54773.1

[Show Plain Result]


## Summary of Sequence Search
    1::112
  513::621     4e-07  22%  775 aa  YHGE_BACSU RecName: Full=Uncharacterized protein yhgE;AltName:
    1::112

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxGSGKLAEGGTKLTSGLEDLQTGLASLGQGLGNASDQLKSVSTESKNAEILSNPLNLSKTDNDQVPVN
YHGE_BACSU      ---GSSKLADGSASXXXXXXXXXXXXXELSSKLKDAADQTGDIDADDQTYGMFADPVKTKDDAIHSVPNY


                         .         .         *         .         .         .         .:140
query           GIAIAPYMISVALFFAAISTNMIFAKLPSGRHPESRWAWLKS
YHGE_BACSU      GTGLTPYILSMGLYVGGIMLTVVFPLKEASGRPRNGFEWFFS