[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF54777.1

[Show Plain Result]


## Summary of Sequence Search
    1::605
   59::597     3e-16  31%  603 aa  OATA_STAAW RecName: Full=O-acetyltransferase oatA;       
   59::597     3e-16  31%  603 aa  OATA_STAAS RecName: Full=O-acetyltransferase oatA;       
   59::597     3e-16  31%  603 aa  OATA_STAAR RecName: Full=O-acetyltransferase oatA;       
   59::597     3e-16  31%  603 aa  OATA_STAAN RecName: Full=O-acetyltransferase oatA;       
   59::597     3e-16  31%  603 aa  OATA_STAAM RecName: Full=O-acetyltransferase oatA;       
   59::597     3e-16  31%  603 aa  OATA_STAAC RecName: Full=O-acetyltransferase oatA;       
   59::597     3e-16  31%  603 aa  OATA_STAA8 RecName: Full=O-acetyltransferase oatA;       
   57::584     2e-10  26%  604 aa  OTRF1_STAAW RecName: Full=Putative O-acetyltransferase MW0856;     
   57::584     2e-10  26%  604 aa  OTRF1_STAAS RecName: Full=Putative O-acetyltransferase SAS0844;    
   57::222     2e-10  27%  604 aa  OTRF1_STAAR RecName: Full=Putative O-acetyltransferase SAR0937;    
   57::584     2e-10  26%  604 aa  OTRF1_STAAN RecName: Full=Putative O-acetyltransferase SA0834;     
   57::584     2e-10  26%  604 aa  OTRF1_STAAM RecName: Full=Putative O-acetyltransferase SAV0974;    
   57::222     2e-10  27%  604 aa  OTRF1_STAAC RecName: Full=Putative O-acetyltransferase SACOL0978;  
   52::634     2e-08  25%  634 aa  YRHL_BACSU RecName: Full=Putative peptidoglycan O-acetyltransferase
   11::194     8e-06  26%  245 aa  Y392_HAEIN RecName: Full=Uncharacterized protein HI0392;
  292::441     2e-04  30%  451 aa  GLMM_STACT RecName: Full=Phosphoglucosamine mutase;       
   45::183     3e-04  30%  499 aa  PIT_BUCBP RecName: Full=Low-affinity inorganic phosphate
  909::1067    5e-04  25% 1151 aa  OGT1_CAEEL RecName: Full=UDP-N-acetylglucosamine--peptide
   76::222     6e-04  24%  386 aa  BCSY_ACEXY RecName: Full=Putative membrane-bound transacylase bcsY;
    1::605

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLITALLIEEFSKNHEIDLIGFFRRRFY
OATA_STAAW      -------------------------------------------LITSLLISEYYRTQKIDLLEFWKRRLK
OATA_STAAS      -------------------------------------------LITSLLISEYYRTQKIDLLEFWKRRLK
OATA_STAAR      -------------------------------------------LITSLLISEYYRTQKIDLLEFWKRRLK
OATA_STAAN      -------------------------------------------LITSLLISEYYRTQKIDLLEFWKRRLK
OATA_STAAM      -------------------------------------------LITSLLISEYYRTQKIDLLEFWKRRLK
OATA_STAAC      -------------------------------------------LITSLLISEYYRTQKIDLLEFWKRRLK
OATA_STAA8      -------------------------------------------LITSLLISEYYRTQKIDLLEFWKRRLK
OTRF1_STAAW     -------------------------------------------LITSLLLKEYDDTGIIKLKSFWIRRLK
OTRF1_STAAS     -------------------------------------------LITSLLLKEYDDTGIIKLKSFWIRRLK
OTRF1_STAAR     -------------------------------------------LITSLLLKEYDDTGIIKLKSFWIRRLK
OTRF1_STAAN     -------------------------------------------LITSLLLKEYDDTGIIKLKSFWIRRLK
OTRF1_STAAM     -------------------------------------------LITSLLLKEYDDTGIIKLKSFWIRRLK
OTRF1_STAAC     -------------------------------------------LITSLLLKEYDDTGIIKLKSFWIRRLK
YRHL_BACSU      -------------------------------------------LITSILLPAYGNDINLDFRDFWVRRIR
Y392_HAEIN      -------------------------------------------LITGIIITEIQQN-SFSLKQFYTRRIK
GLMM_STACT      ----------------------------------------------------------------------
PIT_BUCBP       ----------------------------------------------------------------------
OGT1_CAEEL      ----------------------------------------------------------------------
BCSY_ACEXY      --------------------------------------------------------HPFQPVRFVCRRLY


                         .         .         *         .         .         .         .:140
query           RIXXXXXXXXXXXXXFTFLVRQDYVAGIGGQIASVLGFMTNFYELLTGGSYESQFIPHLFVHNWSLAVEV
OATA_STAAW      RLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAAIFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEE
OATA_STAAS      RLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAAIFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEE
OATA_STAAR      RLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAAIFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEE
OATA_STAAN      RLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAAIFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEE
OATA_STAAM      RLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAAIFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEE
OATA_STAAC      RLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAAIFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEE
OATA_STAA8      RLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAAIFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEE
OTRF1_STAAW     RLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIFYVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEE
OTRF1_STAAS     RLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIFYVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEE
OTRF1_STAAR     RLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIFYVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEE
OTRF1_STAAN     RLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIFYVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEE
OTRF1_STAAM     RLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIFYVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEE
OTRF1_STAAC     RLLPAVIVLLMVVGTATLLLKSDNIIRVKHDIIAAIFYVSNWWYIAKDVNYFEQFSFMPLKHLWSLAIEE
YRHL_BACSU      RLLPAAYLMIFSTVVWVVLFDRELLHTVRGDAISSLFYMSNWWFIFHKLSYFDSFSPSPLKNLWSLAIEE
Y392_HAEIN      RIYPAFITVMALVSFIAIFIYNDFNK-LRKTIELAIAFLSNFYLGLTQGYFDLSANENPVLHIWSLAVEG
GLMM_STACT      ----------------------------------------------------------------------
PIT_BUCBP       -----------------------YTRSMNEKMAILISGILNFLGVFFGGLSIAYAIIYLLPSNLLLNINT
OGT1_CAEEL      ----------------------------------------------------------------------
BCSY_ACEXY      RLLPALLCMVALVSAMLWWVLQSDRADIALNGAYALVYLSNIWASGHVGYFQGQAVAYPFLHTWSLSLEM


                         +         .         .         .         .         *         .:210
query           HYYILWGLAVWFLSKQAKSNGQLKGMVFLLSAVAFLISFFSMFIGSFLVTSYSSVYFSSLTHVYPFFLGS
OATA_STAAW      QFYLLFPLVITFLLHRFKPRNIIQ-TLFIVS----LISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGC
OATA_STAAS      QFYLLFPLVITFLLHRFKPRNIIQ-TLFIVS----LISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGC
OATA_STAAR      QFYLLFPLVITFLLHRFKPRNIIQ-TLFIVS----LISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGC
OATA_STAAN      QFYLLFPLVITFLLHRFKPRNIIQ-TLFIVS----LISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGC
OATA_STAAM      QFYLLFPLVITFLLHRFKPRNIIQ-TLFIVS----LISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGC
OATA_STAAC      QFYLLFPLVITFLLHRFKPRNIIQ-TLFIVS----LISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGC
OATA_STAA8      QFYLLFPLVITFLLHRFKPRNIIQ-TLFIVS----LISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGC
OTRF1_STAAW     QFYIFFPVILVTLLLTIKKRYKIG---FIFWGVSIISLGLMMFIYS-INGDHSRVYFGTDTRLQTLLLGV
OTRF1_STAAS     QFYIFFPVILVTLLLTIKKRYKIG---FIFWGVSIISLGLMMFIYS-INGDHSRVYFGTDTRLQTLLLGV
OTRF1_STAAR     QFYIFFPVILVTLLLTIKKRYKIG---FIFWGVSIISLGLMMFIYS-INGDHSRVYFGTDTRLQTLLLGV
OTRF1_STAAN     QFYIFFPVILVTLLLTIKKRYKIG---FIFWGVSIISLGLMMFIYS-INGDHSRVYFGTDTRLQTLLLGV
OTRF1_STAAM     QFYIFFPVILVTLLLTIKKRYKIG---FIFWGVSIISLGLMMFIYS-INGDHSRVYFGTDTRLQTLLLGV
OTRF1_STAAC     QFYIFFPVILVTLLLTIKKRYKIG---FIFWGVSIISLGLMMFIYS-INGDHSRVYFGTDTRLQTLLLGV
YRHL_BACSU      QFYIIWPMFLVVGMYIMKSRARLAAVISLL----VLCSAVMMSVLYEPGGDPSRVYYGTDTRSFELLIGC
Y392_HAEIN      QYYLIFPLILILAYKKFREVKVXXXXXXXXXXXXXATSFVS---ANFYVLHQPNIYYLSNLRFPELLVGS
GLMM_STACT      ----------------------------------------------------------------------
PIT_BUCBP       SCAILWNLCTWYLSLPTSSSHTLIGSI-------IGINFVNAFINNFSILSLIS--FNKIIYV---FLSL
OGT1_CAEEL      ----------------------------------------------------------------------
BCSY_ACEXY      QFYAIIFIMALLLPLTRHRR-------LVLSAI---FSASAAYCAYAWHTGDSQAYYNILDRLWQFALGT


                         .         .         .         +         .         .         .:280
query           MLATIVGVRQTTSLVKQLDKIWDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
OATA_STAAW      ILAFI-----------------------------------------------------------------
OATA_STAAS      ILAFI-----------------------------------------------------------------
OATA_STAAR      ILAFI-----------------------------------------------------------------
OATA_STAAN      ILAFI-----------------------------------------------------------------
OATA_STAAM      ILAFI-----------------------------------------------------------------
OATA_STAAC      ILAFI-----------------------------------------------------------------
OATA_STAA8      ILAFI-----------------------------------------------------------------
OTRF1_STAAW     ILA-------------------------------------------------------------------
OTRF1_STAAS     ILA-------------------------------------------------------------------
OTRF1_STAAR     ILA-------------------------------------------------------------------
OTRF1_STAAN     ILA-------------------------------------------------------------------
OTRF1_STAAM     ILA-------------------------------------------------------------------
OTRF1_STAAC     ILA-------------------------------------------------------------------
YRHL_BACSU      ALALVWPMKRLSS---------------------------------------------------------
Y392_HAEIN      LLAIYHNLSNKVQLSKQV----------------------------------------------------
GLMM_STACT      ----------------------------------------------------------------------
PIT_BUCBP       ILSPICGLIIAGSLVFLLKKYYN-----------------------------------------------
OGT1_CAEEL      ----------------------------------------------------------------------
BCSY_ACEXY      MV--------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
OATA_STAAW      ----------------------------------------------------------------------
OATA_STAAS      ----------------------------------------------------------------------
OATA_STAAR      ----------------------------------------------------------------------
OATA_STAAN      ----------------------------------------------------------------------
OATA_STAAM      ----------------------------------------------------------------------
OATA_STAAC      ----------------------------------------------------------------------
OATA_STAA8      ----------------------------------------------------------------------
OTRF1_STAAW     ----------------------------------------------------------------------
OTRF1_STAAS     ----------------------------------------------------------------------
OTRF1_STAAR     ----------------------------------------------------------------------
OTRF1_STAAN     ----------------------------------------------------------------------
OTRF1_STAAM     ----------------------------------------------------------------------
OTRF1_STAAC     ----------------------------------------------------------------------
YRHL_BACSU      ----------------------------------------------------------------------
Y392_HAEIN      ----------------------------------------------------------------------
GLMM_STACT      ----------------------------------------------------------------------
PIT_BUCBP       ----------------------------------------------------------------------
OGT1_CAEEL      ----------------------------------------------------------------------
BCSY_ACEXY      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLAPQVGAFETDLTVNGLKQAATNIGQTKVMAER
OATA_STAAW      ----------------------------------------------------------------------
OATA_STAAS      ----------------------------------------------------------------------
OATA_STAAR      ----------------------------------------------------------------------
OATA_STAAN      ----------------------------------------------------------------------
OATA_STAAM      ----------------------------------------------------------------------
OATA_STAAC      ----------------------------------------------------------------------
OATA_STAA8      ----------------------------------------------------------------------
OTRF1_STAAW     ------------------------------------IIGEKANSFDTTIEDNYLMRIAPNIHIDGLVSEK
OTRF1_STAAS     ------------------------------------IIGEKANSFDTTIEDNYLMRIAPNIHIDGLVSEK
OTRF1_STAAR     ----------------------------------------------------------------------
OTRF1_STAAN     ------------------------------------IIGEKANSFDTTIEDNYLMRIAPNIHIDGLVSEK
OTRF1_STAAM     ------------------------------------IIGEKANSFDTTIEDNYLMRIAPNIHIDGLVSEK
OTRF1_STAAC     ----------------------------------------------------------------------
YRHL_BACSU      ----------------------------------------------------------------------
Y392_HAEIN      ----------------------------------------------------------------------
GLMM_STACT      --------------------------------------------FYKALEAEGIKSNKTKVGDRYVVEEM
PIT_BUCBP       ----------------------------------------------------------------------
OGT1_CAEEL      ----------------------------------------------------------------------
BCSY_ACEXY      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ADANSLGIADGTMLIGDSVALRANTALQTALPGAQINAQVSVTTKTANEIMLNNSQNKFLPKTVVIATGV
OATA_STAAW      ------------LLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLVDATPIV--KSQYKDYAKKVVVELGT
OATA_STAAS      ------------LLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLVDATPIV--KSQYKDYAKKVVVELGT
OATA_STAAR      ------------LLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLVDATPIV--KSQYKDYAKKVVVELGT
OATA_STAAN      ------------LLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLVDATPIV--KSQYKDYAKKVVVELGT
OATA_STAAM      ------------LLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLVDATPIV--KSQYKDYAKKVVVELGT
OATA_STAAC      ------------LLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLVDATPIV--KSQYKDYAKKVVVELGT
OATA_STAA8      ------------LLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLVDATPIV--KSQYKDYAKKVVVELGT
OTRF1_STAAW     KKESSDVYNNKPLLIGDSVMVDIGESFKSSVPKSRIDGKVGRQLQTLPLVKANYSQYKKSSDQVVLELGT
OTRF1_STAAS     KKESSDVYNNKPLLIGDSVMVDIGESFKSSVPKSRIDGKVGRQLQTLPLVKANYSQYKKSSDQVVLELGT
OTRF1_STAAR     ----------------------------------------------------------------------
OTRF1_STAAN     KKESSDVYNNKPLLIGDSVMVDIGESFKSSVPKSRIDGKVGRQLQTLPLVKANYSQYKKSSDQVVLELGT
OTRF1_STAAM     KKESSDVYNNKPLLIGDSVMVDIGESFKSSVPKSRIDGKVGRQLQTLPLVKANYSQYKKSSDQVVLELGT
OTRF1_STAAC     ----------------------------------------------------------------------
YRHL_BACSU      --------AKEVLAIGDSVMLDISSHLRQSFSNVTIDGKVGRQMSQALELAREYKSFNQPNKAVIIELGT
Y392_HAEIN      ----------------------------------------------------------------------
GLMM_STACT      RKGNNLGGEQS----GHIVLMDYNTTGDGLLTGVQLAAVVKLTGKSLSELA---EQMKKYPQSLINVRGV
PIT_BUCBP       ----------------------------------------------------------------------
OGT1_CAEEL      --------------------------VQNGLGQSQMHHKAATGEEIPNSVLLTSRAQYQLPDDAIVFCNF
BCSY_ACEXY      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NNPENYKDDWDSIVKNLPKGHHMILVTPYEGDKTKETYAIVEKAAAYMRELAEKTPYITIADWNQVAKEH
OATA_STAAW      NGAFT-KDQLNELLDSFGKADIYLVSIDYEGRINKLIY-----------EAAEKRSNVHLVDWYKASAGH
OATA_STAAS      NGAFT-KDQLNELLDSFGKADIYLVSIDYEGRINKLIY-----------EAAEKRSNVHLVDWYKASAGH
OATA_STAAR      NGAFT-KDQLNELLDSFGKADIYLVSIDYEGRINKLIY-----------EAAEKRSNVHLVDWYKASAGH
OATA_STAAN      NGAFT-KDQLNELLDSFGKADIYLVSIDYEGRINKLIY-----------EAAEKRSNVHLVDWYKASAGH
OATA_STAAM      NGAFT-KDQLNELLDSFGKADIYLVSIDYEGRINKLIY-----------EAAEKRSNVHLVDWYKASAGH
OATA_STAAC      NGAFT-KDQLNELLDSFGKADIYLVSIDYEGRINKLIY-----------EAAEKRSNVHLVDWYKASAGH
OATA_STAA8      NGAFT-KDQLNELLDSFGKADIYLVSIDYEGRINKLIY-----------EAAEKRSNVHLVDWYKASAGH
OTRF1_STAAW     NGDFTVKQ-LDDLLNQFGKAKIYLVNTRYEANVNR-----------LLADAAKRKSNVTLIDWNKRSQGH
OTRF1_STAAS     NGDFTVKQ-LDDLLNQFGKAKIYLVNTRYEANVNR-----------LLADAAKRKSNVTLIDWNKRSQGH
OTRF1_STAAR     ----------------------------------------------------------------------
OTRF1_STAAN     NGDFTVKQ-LDDLLNQFGKAKIYLVNTRYEANVNR-----------LLADAAKRKSNVTLIDWNKRSQGH
OTRF1_STAAM     NGDFTVKQ-LDDLLNQFGKAKIYLVNTRYEANVNR-----------LLADAAKRKSNVTLIDWNKRSQGH
OTRF1_STAAC     ----------------------------------------------------------------------
YRHL_BACSU      NGYFT-NSQIEQLLQSFSKAHIYLVNTRVPRQESKVNESLQQQAHAHQN--------VTLVDWHTEALQH
Y392_HAEIN      ----------------------------------------------------------------------
GLMM_STACT      TDNEDVKAEMDRVEADM-NGEGRILVRPSGTERVMVEAATDEKAQSYAQQIAD-----------------
PIT_BUCBP       ----------------------------------------------------------------------
OGT1_CAEEL      N--QLYKIDWIKILENVPKSILWLLRFPYQGEEHIRKYCVLDPSRIVFSNVAAKEEHVRRGQLADVCLDT
BCSY_ACEXY      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PEIWAGTDQVHFGSESSTIEAGAKLYADTIATALQTxxxxxxxxx
OATA_STAAW      PEYFA-YDGIHLE------YAGSKALTDLIVKTMET---------
OATA_STAAS      PEYFA-YDGIHLE------YAGSKALTDLIVKTMET---------
OATA_STAAR      PEYFA-YDGIHLE------YAGSKALTDLIVKTMET---------
OATA_STAAN      PEYFA-YDGIHLE------YAGSKALTDLIVKTMET---------
OATA_STAAM      PEYFA-YDGIHLE------YAGSKALTDLIVKTMET---------
OATA_STAAC      PEYFA-YDGIHLE------YAGSKALTDLIVKTMET---------
OATA_STAA8      PEYFA-YDGIHLE------YAGSKALTDLIVKTMET---------
OTRF1_STAAW     SEYFA-PDGVH----------------------------------
OTRF1_STAAS     SEYFA-PDGVH----------------------------------
OTRF1_STAAR     ---------------------------------------------
OTRF1_STAAN     SEYFA-PDGVH----------------------------------
OTRF1_STAAM     SEYFA-PDGVH----------------------------------
OTRF1_STAAC     ---------------------------------------------
YRHL_BACSU      PEYFT-PDGVHL------VPKGAKTLTALIVQAMKS---------
Y392_HAEIN      ---------------------------------------------
GLMM_STACT      ---------------------------------------------
PIT_BUCBP       ---------------------------------------------
OGT1_CAEEL      PILWTGTPMVTMPLESASRVATSQLYA------------------
BCSY_ACEXY      ---------------------------------------------