[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF54833.1

[Show Plain Result]


## Summary of Sequence Search
    1::290
   21::144     1e-04  34%  575 aa  SP6D_BACSU RecName: Full=Stage VI sporulation protein D;
  131::243     5e-04  31%  338 aa  HEM1_CHLAB RecName: Full=Glutamyl-tRNA reductase;       
    1::290

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEVKSLLSAHLD
SP6D_BACSU      ----------------------------------------------------------QEVSELLSISLD
HEM1_CHLAB      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PNSVDAFFNLVNDYNTIVGSTGLSGDFTSFTHTEYDVEKISHLWNQKKGDFVGTNCRINSYCLLKNSVTI
SP6D_BACSU      P---DIRVQEVNDYVSIIGSLELTGEYNQNKHTETDKRFVEQVRKREDGSAELTHCFPVDITIPKNKVSI
HEM1_CHLAB      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PKLEKNDQLLFLDNDAIDKGKVFDSQDKEEFDILFSRVPTEATTDVKVHAEKMETFFSQFQFNEKARMLS
SP6D_BACSU      DAFDTDSRILTIQADLAIEGLLDDTQDKE-----------------------------------------
HEM1_CHLAB      --------LHFLFQKALKEGKDFRSQVSLSHPVVTIESVVEETLDLHGKSTKDKLLFIGYEINRKAKGLS


                         .         .         .         +         .         .         .:280
query           VVLHDNLDGEYLFVGHVGVLVPTDDGFLFVEKLTFEEPYQAIKFASKEDCYKYLGxxxxxxxxxxxxxxx
SP6D_BACSU      ----------------------------------------------------------------------
HEM1_CHLAB      AKGYRNL----IFCSRKNISIPYDT--VARSQLSFREPYDVIFFGSSESAKDFSG---------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxx
SP6D_BACSU      ----------
HEM1_CHLAB      ----------