[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF54875.1

[Show Plain Result]


## Summary of Sequence Search
    1::738
    4::710     e-161  41%  733 aa  AGAL1_PEDPE RecName: Full=Alpha-galactosidase 1;       
    7::715     e-131  38%  720 aa  AGAL_STRMU RecName: Full=Alpha-galactosidase;       
   92::745     e-124  38%  747 aa  AGALC_ASPNG RecName: Full=Alpha-galactosidase C;       
   20::706     e-124  36%  719 aa  AGAL2_PEDPE RecName: Full=Alpha-galactosidase 2;       
  144::652     1e-77  33%  708 aa  RAFA_ECOLX RecName: Full=Alpha-galactosidase;       
   38::181     4e-10  31%  436 aa  AGAL_SCHPO RecName: Full=Probable alpha-galactosidase;       
   35::113     7e-09  38%  471 aa  MEL5_YEAST RecName: Full=Alpha-galactosidase 5;       
   35::113     2e-08  36%  471 aa  MEL6_YEAST RecName: Full=Alpha-galactosidase 6;       
   35::113     2e-08  36%  471 aa  MEL2_YEAST RecName: Full=Alpha-galactosidase 2;       
   35::113     2e-08  36%  471 aa  MEL1_YEAST RecName: Full=Alpha-galactosidase 1;       
   35::113     1e-07  38%  470 aa  MEL_ZYGMR RecName: Full=Alpha-galactosidase;       
   35::113     1e-07  35%  471 aa  MEL_SACPA RecName: Full=Alpha-galactosidase;       
   68::119     1e-07  46%  411 aa  NAGAB_BOVIN RecName: Full=Alpha-N-acetylgalactosaminidase;       
   35::113     2e-07  35%  471 aa  MEL_SACPS RecName: Full=Alpha-galactosidase;       
   69::193     2e-07  33%  417 aa  AGAL_ORYSJ RecName: Full=Alpha-galactosidase;       
   34::112     4e-07  35%  469 aa  MEL_ZYGCI RecName: Full=Alpha-galactosidase;       
   35::113     2e-06  34%  471 aa  MEL_SACMI RecName: Full=Alpha-galactosidase;       
   68::119     2e-06  42%  415 aa  NAGAB_RAT RecName: Full=Alpha-N-acetylgalactosaminidase;       
   68::119     3e-06  42%  415 aa  NAGAB_MOUSE RecName: Full=Alpha-N-acetylgalactosaminidase;       
   68::119     3e-06  40%  411 aa  NAGAB_HUMAN RecName: Full=Alpha-N-acetylgalactosaminidase;       
   44::140     1e-05  33%  411 aa  AGAL_CYATE RecName: Full=Alpha-galactosidase;       
   25::151     1e-05  32%  378 aa  AGAL_COFAR RecName: Full=Alpha-galactosidase;       
   36::114     1e-05  32%  474 aa  MEL_TORDE RecName: Full=Alpha-galactosidase;       
   82::167     1e-05  37%  419 aa  AGAL_MOUSE RecName: Full=Alpha-galactosidase A;       
   33::111     1e-05  34%  385 aa  AGAL_DICDI RecName: Full=Probable alpha-galactosidase;       
   43::126     2e-05  32%  545 aa  AGAL_ASPNG RecName: Full=Alpha-galactosidase A;       
   75::167     4e-05  35%  429 aa  AGAL_HUMAN RecName: Full=Alpha-galactosidase A;       
  144::235     1e-04  32%  439 aa  YDDW_SHIFL RecName: Full=UPF0748 lipoprotein yddW;Flags: Precursor;
  144::235     1e-04  32%  439 aa  YDDW_ECOLI RecName: Full=UPF0748 lipoprotein yddW;Flags: Precursor;
  144::235     1e-04  32%  439 aa  YDDW_ECOL6 RecName: Full=UPF0748 lipoprotein yddW;Flags: Precursor;
  144::235     1e-04  32%  439 aa  YDDW_ECO57 RecName: Full=UPF0748 lipoprotein yddW;Flags: Precursor;
   51::103     6e-04  36%  405 aa  NAGAB_CHICK RecName: Full=Alpha-N-acetylgalactosaminidase;       
    1::738

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYEKRGFEVSFSEEFEDIQQ
AGAL1_PEDPE     --ITVDQANRVFHLHNQTLSYIFAVEQGGTLSHLYFGGHV---DHYHGELRYPRRGFSGNLPGSTDTFSR
AGAL_STRMU      --------DNLFYIHTKDSSLIIEXXXXXXIEAYHFSNTVFEKDHFSANPVADNRNYSY-------DTQR
AGALC_ASPNG     ----------------------------------------------------------------------
AGAL2_PEDPE     -------------------SYVIQILAHRYPVHRYFG-RYFSKQPYFEPMPSGSHAFANDPTERFP-YSV
RAFA_ECOLX      ----------------------------------------------------------------------
AGAL_SCHPO      ----------------------------------------------------------------------
MEL5_YEAST      ----------------------------------------------------------------------
MEL6_YEAST      ----------------------------------------------------------------------
MEL2_YEAST      ----------------------------------------------------------------------
MEL1_YEAST      ----------------------------------------------------------------------
MEL_ZYGMR       ----------------------------------------------------------------------
MEL_SACPA       ----------------------------------------------------------------------
NAGAB_BOVIN     ----------------------------------------------------------------------
MEL_SACPS       ----------------------------------------------------------------------
AGAL_ORYSJ      ----------------------------------------------------------------------
MEL_ZYGCI       ----------------------------------------------------------------------
MEL_SACMI       ----------------------------------------------------------------------
NAGAB_RAT       ----------------------------------------------------------------------
NAGAB_MOUSE     ----------------------------------------------------------------------
NAGAB_HUMAN     ----------------------------------------------------------------------
AGAL_CYATE      ----------------------------------------------------------------------
AGAL_COFAR      ----------------------------------------------------------------------
MEL_TORDE       ----------------------------------------------------------------------
AGAL_MOUSE      ----------------------------------------------------------------------
AGAL_DICDI      ----------------------------------------------------------------------
AGAL_ASPNG      ----------------------------------------------------------------------
AGAL_HUMAN      ----------------------------------------------------------------------
YDDW_SHIFL      ----------------------------------------------------------------------
YDDW_ECOLI      ----------------------------------------------------------------------
YDDW_ECOL6      ----------------------------------------------------------------------
YDDW_ECO57      ----------------------------------------------------------------------
NAGAB_CHICK     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQDFELEKGKNRLNSLPSTFDDIGQCAEXXXXXXXX
AGAL1_PEDPE     DTLPKEYSTAGEMDYHLPAAIVRHTDGANALYLVYQGYRIEAGKPKLSGLPAAFVEDETEAETLTIVLVD
AGAL_STRMU      QI----FGVHGFGDFRVPSLILQHDNND-LTXXXXXXXXXXXXXXXXXXLPNPHSS--ESAQSLALILED
AGALC_ASPNG     --IRREFPDQGRGDFRIPAVRIRESAGYTVSDLQYVSHEVIEGKYALPGLPATFGD-AQDATTLVVHLYD
AGAL2_PEDPE     TSLPLEYSTIGSGDYRQPAYVIKDANNQLLPILEYTGFSVNDQPINSRQLPPTVSKHTPVTTLVIHLTDA
RAFA_ECOLX      ----------------------------------------------------------------------
AGAL_SCHPO      ----------------------------------------------------------------------
MEL5_YEAST      ----------------------------------------------------------------------
MEL6_YEAST      ----------------------------------------------------------------------
MEL2_YEAST      ----------------------------------------------------------------------
MEL1_YEAST      ----------------------------------------------------------------------
MEL_ZYGMR       ----------------------------------------------------------------------
MEL_SACPA       ----------------------------------------------------------------------
NAGAB_BOVIN     ----------------------------------------------------------------------
MEL_SACPS       ----------------------------------------------------------------------
AGAL_ORYSJ      ----------------------------------------------------------------------
MEL_ZYGCI       ----------------------------------------------------------------------
MEL_SACMI       ----------------------------------------------------------------------
NAGAB_RAT       ----------------------------------------------------------------------
NAGAB_MOUSE     ----------------------------------------------------------------------
NAGAB_HUMAN     ----------------------------------------------------------------------
AGAL_CYATE      ----------------------------------------------------------------------
AGAL_COFAR      ----------------------------------------------------------------------
MEL_TORDE       ----------------------------------------------------------------------
AGAL_MOUSE      ----------------------------------------------------------------------
AGAL_DICDI      ----------------------------------------------------------------------
AGAL_ASPNG      ----------------------------------------------------------------------
AGAL_HUMAN      ----------------------------------------------------------------------
YDDW_SHIFL      ----------------------------------------------------------------------
YDDW_ECOLI      ----------------------------------------------------------------------
YDDW_ECOL6      ----------------------------------------------------------------------
YDDW_ECO57      ----------------------------------------------------------------------
NAGAB_CHICK     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXVRLNYTIFPEYNVLVRNTEFXXXXXXXXXXXXAMSLQLDLPDSQYDFIQFSGAWLRERQLYRTS
AGAL1_PEDPE     QVSQVEFDLQYTIYRDRPVVTRSVQVCNQGDHAVNLEKVASMQIDFTDRQFETITLPGAHANERHPERGS
AGAL_STRMU      DLAKLRMTLYYTAYDDNATISTFVKFENLSDKPVILHRALSTMFDLPASHYDVITFQGAYAREKTLRRHQ
AGALC_ASPNG     NYSSVAADLSYSIFPKYDAIVRSVNVTNQGPGNITIEALASISIDFPYEDLDMVSLRGDWAREANVQRSK
AGAL2_PEDPE     VTKLQ-MDLNYTIFENQPLILRSTTLRHHGTTNLQVTALSSAQLDLPTDQYTALTLSGTHAHEANPSFNR
RAFA_ECOLX      ----------------------------------------AITLPVAERAEEVMAFHGRWTREFQPHRVR
AGAL_SCHPO      ----------------------------------------------------------------------
MEL5_YEAST      ----------------------------------------------------------------------
MEL6_YEAST      ----------------------------------------------------------------------
MEL2_YEAST      ----------------------------------------------------------------------
MEL1_YEAST      ----------------------------------------------------------------------
MEL_ZYGMR       ----------------------------------------------------------------------
MEL_SACPA       ----------------------------------------------------------------------
NAGAB_BOVIN     ----------------------------------------------------------------------
MEL_SACPS       ----------------------------------------------------------------------
AGAL_ORYSJ      ----------------------------------------------------------------------
MEL_ZYGCI       ----------------------------------------------------------------------
MEL_SACMI       ----------------------------------------------------------------------
NAGAB_RAT       ----------------------------------------------------------------------
NAGAB_MOUSE     ----------------------------------------------------------------------
NAGAB_HUMAN     ----------------------------------------------------------------------
AGAL_CYATE      ----------------------------------------------------------------------
AGAL_COFAR      ----------------------------------------------------------------------
MEL_TORDE       ----------------------------------------------------------------------
AGAL_MOUSE      ----------------------------------------------------------------------
AGAL_DICDI      ----------------------------------------------------------------------
AGAL_ASPNG      ----------------------------------------------------------------------
AGAL_HUMAN      ----------------------------------------------------------------------
YDDW_SHIFL      ----------------------------------------------------------------------
YDDW_ECOLI      ----------------------------------------------------------------------
YDDW_ECOL6      ----------------------------------------------------------------------
YDDW_ECO57      ----------------------------------------------------------------------
NAGAB_CHICK     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LRPGIQAIDSLRYSSSPQQNPFFMLSRRETTEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVE
AGAL1_PEDPE     INYGIQTFGSLRGTSSHQMNPFLALVDHTTTEFSGDAYGFNLVYSGNHAFELEKDQLDQLHLMVGINSYN
AGAL_STRMU      IEQGLFKIGSNRGASGHAQTPSLILTEHDSNEFYGEALALQLIYSGNFQAFVQKNQLNEVRLGIGINDDN
AGALC_ASPNG     VQYGVQGFGSSTGYSSHLHNPFLAIVDPATTESQGEAWGFNLVYTGSFSAQVEKGSQGFTRALLGFNPDQ
AGAL2_PEDPE     LHPGLQTVRSLRGTSGPQHQPFMALAEPNTTELAGTVIGCALAWSGNFDSTVEVDQYQHSRLTIGLEPDT
RAFA_ECOLX      LTHDAFVLENRRGRTSHEHFPALIVGTPGFSEQQGEVWAVHLGWSGNHRMRCEAKTDGRRYVQAEALWMP
AGAL_SCHPO      ----------------------------------------------------------------------
MEL5_YEAST      ----------------------------------------------------------------------
MEL6_YEAST      ----------------------------------------------------------------------
MEL2_YEAST      ----------------------------------------------------------------------
MEL1_YEAST      ----------------------------------------------------------------------
MEL_ZYGMR       ----------------------------------------------------------------------
MEL_SACPA       ----------------------------------------------------------------------
NAGAB_BOVIN     ----------------------------------------------------------------------
MEL_SACPS       ----------------------------------------------------------------------
AGAL_ORYSJ      ----------------------------------------------------------------------
MEL_ZYGCI       ----------------------------------------------------------------------
MEL_SACMI       ----------------------------------------------------------------------
NAGAB_RAT       ----------------------------------------------------------------------
NAGAB_MOUSE     ----------------------------------------------------------------------
NAGAB_HUMAN     ----------------------------------------------------------------------
AGAL_CYATE      ----------------------------------------------------------------------
AGAL_COFAR      ----------------------------------------------------------------------
MEL_TORDE       ----------------------------------------------------------------------
AGAL_MOUSE      ----------------------------------------------------------------------
AGAL_DICDI      ----------------------------------------------------------------------
AGAL_ASPNG      ----------------------------------------------------------------------
AGAL_HUMAN      ----------------------------------------------------------------------
YDDW_SHIFL      ----------------------------------------------------------------------
YDDW_ECOLI      ----------------------------------------------------------------------
YDDW_ECOL6      ----------------------------------------------------------------------
YDDW_ECO57      ----------------------------------------------------------------------
NAGAB_CHICK     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FRFLLNPAESFVTPEAIVIYSDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKIL
AGAL1_PEDPE     FNWQLKAGATFQTPEVLMVYTNKGLNAMSQAYHHLIRERVVRSEFKNQERPIVVNNWEATFFDFNEAKLK
AGAL_STRMU      FSWDLQANQSFETPVALITYTDKGLTDLTQESHNFIKRHIIPKNFANKERPILINNWEATYFDFNRSQLL
AGALC_ASPNG     LSWNLGPGETLTSPECVAVYSDKGLGSVSRKFHRLYRNHLMKSKFATSDRPVLLNSWEGVYFDYNQSSIE
AGAL2_PEDPE     FEWQLKPNSSFQTPEAVLTWTNTGFNGMSQVFHDF--SYQLMP--SQTNIPSVLNTWETLTFAVSESKVQ
RAFA_ECOLX      GEKALRKNETLYTPWLYACHSADGLNGMSQQYHRFLRDEIIRFP-EQKLRPVHLNTWEGIYFNHNPDYIM
AGAL_SCHPO      ------------------------------------------------------NSWNKYACDIDESIIL
MEL5_YEAST      ------------------------------------------------------DSWNTFACDVSEQLLL
MEL6_YEAST      ------------------------------------------------------DNWNTFACDVSEQLLL
MEL2_YEAST      ------------------------------------------------------DNWNTFACDVSEQLLL
MEL1_YEAST      ------------------------------------------------------DNWNTFACDVSEQLLL
MEL_ZYGMR       ------------------------------------------------------NNWNTFACNVTEQLLL
MEL_SACPA       ------------------------------------------------------DNWNTFACNVSEDLLL
NAGAB_BOVIN     ----------------------------------------------------------------------
MEL_SACPS       ------------------------------------------------------DNWNTFACDVSEQLLL
AGAL_ORYSJ      ------------------------------------------------------NSWNHFYCGINEQIIR
MEL_ZYGCI       ------------------------------------------------------DNWNSFGCSVKEELLL
MEL_SACMI       ------------------------------------------------------DNWNTFACDVSEQLLL
NAGAB_RAT       ----------------------------------------------------------------------
NAGAB_MOUSE     ----------------------------------------------------------------------
NAGAB_HUMAN     ----------------------------------------------------------------------
AGAL_CYATE      ------------------------------------RRYLAENGLGQTP-PMGWNSWNHFGCDINENVVR
AGAL_COFAR      --------------------------------------------------PMGWNSWNHFRCNLDEKLIR
MEL_TORDE       ------------------------------------------------------NNWNTFACNVSEDLLL
AGAL_MOUSE      ----------------------------------------------------------------------
AGAL_DICDI      ------------------------------------------------------SSWNFYACNINESVIM
AGAL_ASPNG      --------------------------------------------------PMGFNNWARFMCDLNETLFT
AGAL_HUMAN      ---------------------------------------------------------------------L
YDDW_SHIFL      ----------------------------------------------------------------------
YDDW_ECOLI      ----------------------------------------------------------------------
YDDW_ECOL6      ----------------------------------------------------------------------
YDDW_ECO57      ----------------------------------------------------------------------
NAGAB_CHICK     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DLAKAAKDLGIELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
AGAL1_PEDPE     PIVDEAKQLGIEMFVLDDGWFGHRDDDNSSLGDWQVDHRKFPQGLNHFVKYVHEQGLKFGIWLEPEMISY
AGAL_STRMU      GLADEARKLGIELFVLDDGWFGHRFDDNSSLGDWFVNEEKLGGSLDSFIKEIHDRGLQFGLWFEPEMVSV
AGALC_ASPNG     TLAEESAALGVHLFVMDDGWFGDRVSDNAGLGDWMPNPARFPDGLTPVVQDITNLKLRFGIWVEPEMVNP
AGAL2_PEDPE     HLIEHAHQLGLQMLVLDDGWFVNRNGENGQLGDWFVDPIKFPNGLNPLAQQAHHHRMKFGLWVEPEMITT
RAFA_ECOLX      QMAERAAALGVERFIIDDGWFKGRNDDRAALGDWYTDEQKYPNGLMPVINHVKSLGMEFGIWVEPEMINP
AGAL_SCHPO      NNAKAIKDLGYEYIVMDDCWSKHERN--ATTGRLEANPDKFPNGIGSMAKKLHDMGFKFGMYSSAGKYTI
MEL5_YEAST      DTADGLKDMGYKYVILDDCWSSGRDSD----GFLVADKHKFPNGMGHVADHLHNNSFLFGMY--------
MEL6_YEAST      DTADGLKDMGYKYVILDDCWSSGRDSD----GFLVADKHKFPNGMGHVADHLHNNSFLFGMY--------
MEL2_YEAST      DTADGLKDMGYKYIILDDCWSSGRDSD----GFLVADEQKFPNGMGHVADHLHNNSFLFGMY--------
MEL1_YEAST      DTADGLKDMGYKYIILDDCWSSGRDSD----GFLVADEQKFPNGMGHVADHLHNNSFLFGMY--------
MEL_ZYGMR       GTADGLKDVGYNYVILDDCWSGGR----SSNGSLVPDLNKFPHGMKYVADHLHDQDLLFGMY--------
MEL_SACPA       NTADGLKDLGYKYVILDDCWSSGRDED----GFLVADEQKFPNGMGHVADRLHNNSFLFGMY--------
NAGAB_BOVIN     ------RDLGYVYLNIDDCWIGGR----DAKGNLVPDRKRFPHGIAFLADYAHSLGLKLGIY--------
MEL_SACPS       DTADGLKDLGYTYVILDDCWSSGR----TANGTLVADKEKFPNGMSHVADHLHNNNFLFGMY--------
AGAL_ORYSJ      ETADALVNLGYQYVNIDDCWAEYSRD---SQGNFVPNRQTFPSGIKALADYVHAKGLKLGIYSDPGSLDH
MEL_ZYGCI       GTAEGLKDLGYNYIILDDCWSSGR----SSNGSLLADDSKFPHGMKYVAEQLHNSQLKFGMY--------
MEL_SACMI       NTADGLKDLGYKYVILDDCWSSGR----NSNGTLVADKNKFPNGMDHVARHLHNNNFLFGMY--------
NAGAB_RAT       ------RDLGYVYLNIDDCWIGGR----DATGRLIPDPKRFPHGIAFLADYAHSLGLKLGIY--------
NAGAB_MOUSE     ------RDLGYVYLNIDDCWIGGR----DASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIY--------
NAGAB_HUMAN     ------RDMGYTYLNIDDCWIGGR----DASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIY--------
AGAL_CYATE      ETADAMVSLGYQYINLDDCWAELNRDSE---GNMVPNAAAFPSGIKALADYVHSKGLKLGVY--------
AGAL_COFAR      ETAKGLAALGYKYINLDDCWAELNRD---SQGNLVPKGSTFPSGIKALADYVHSKGLKLGIYSDPGSLGH
MEL_TORDE       STALGLRDIGYHYVILDDCW----SDGRDSDGMLVPDSTKFPNGMKHVADYLHGKDFLFGMY--------
AGAL_MOUSE      ------RDAGYDYLCIDDCWMAPERDSKGRLQ---ADPQRFPSGIKHLANYVHSKGLKLGIYFPGSFGSY
AGAL_DICDI      NTAKAMADAGYTYVNIDDCWAGGRYPN----GTVYADPTNFPNGIKYVADYIHSLGLKIGIY--------
AGAL_ASPNG      ETANGLRDAGYNRINLDDCWMAYQRSDNGSL-QWNT--TKFPHGLPWLAKYVKAKGFHFGIY--------
AGAL_HUMAN      MVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQ---ADPQRFPHGIRQLANYVHSKGLKLGIYFPGSFGYY
YDDW_SHIFL      ----------------------------------------------FMLDEAHKRGMKVHAWFNPYRVSV
YDDW_ECOLI      ----------------------------------------------FMLDEAHKRGMKVHAWFNPYRVSV
YDDW_ECOL6      ----------------------------------------------FMLDEAHKRGMKVHAWFNPYRVSV
YDDW_ECO57      ----------------------------------------------FMLDEAHKRGMKVHAWFNPYRVSV
NAGAB_CHICK     ------RELGYKYINIDDCWAAKQRDAEGRL---VPDPERFPRGIKALADYVHARGLKLDIY--------


                         .         .         +         .         .         .         .:490
query           DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDMNRHITDIYSI
AGAL1_PEDPE     DSKLYQQHPDYLMQVPGRSPSPSRNQYILDLGRQAVRNNIFDQLDQLLKSKQIDYIKWDMNRHLSDIYSV
AGAL_STRMU      DSKLYRAHPDWVIQADQREHTYSRNQLVLNLANPDVVAYIKTVLDKLLTENTIDYVKWDYNRNITNIGNG
AGALC_ASPNG     NSTLYHEHPEWALHAGPYPRTERRNQLVLNLALPAVQDFIIDFMTNLLQDTGISYVKWDNNRGIHETPSP
AGAL2_PEDPE     NSQLYQQHPDWVLQYVDRTPITARHQLVLDLSQAAVRDHLITTLTNLVQNNQLDYLKWDMNRHLTQVGST
RAFA_ECOLX      DSDLFRLHPDWILSMPGYSQPTGRYQYVLNLNIPEAFDYIYKRFLWLLGEHPVDYVKWDMNRELVQA---
AGAL_SCHPO      DADTF---ADWGVDYLKYDNCFNEGKSGVPLISYERYKRMSDALNK------------------------
MEL5_YEAST      ----------------------------------------------------------------------
MEL6_YEAST      ----------------------------------------------------------------------
MEL2_YEAST      ----------------------------------------------------------------------
MEL1_YEAST      ----------------------------------------------------------------------
MEL_ZYGMR       ----------------------------------------------------------------------
MEL_SACPA       ----------------------------------------------------------------------
NAGAB_BOVIN     ----------------------------------------------------------------------
MEL_SACPS       ----------------------------------------------------------------------
AGAL_ORYSJ      EEQDVKTFASWGVDYLDNCNDAGRS---------------------------------------------
MEL_ZYGCI       ----------------------------------------------------------------------
MEL_SACMI       ----------------------------------------------------------------------
NAGAB_RAT       ----------------------------------------------------------------------
NAGAB_MOUSE     ----------------------------------------------------------------------
NAGAB_HUMAN     ----------------------------------------------------------------------
AGAL_CYATE      ----------------------------------------------------------------------
AGAL_COFAR      EEQDAKTFASWGVDYLKYDNCNNNN---------------------------------------------
MEL_TORDE       ----------------------------------------------------------------------
AGAL_MOUSE      DIDA-QTFADWGVDLL------------------------------------------------------
AGAL_DICDI      ----------------------------------------------------------------------
AGAL_ASPNG      ----------------------------------------------------------------------
AGAL_HUMAN      DIDA-QTFADWGVDLL------------------------------------------------------
YDDW_SHIFL      NASVYVQHRDWIRTSGDR--------FVLDPGIPEVQDWITSIVAEVVSRYPVDGVQFD-----------
YDDW_ECOLI      NASVYVQHRDWIRTSGDR--------FVLDPGIPEVQDWITSIVAEVVSRYPVDGVQFD-----------
YDDW_ECOL6      NASVYVQHRDWIRTSGDR--------FVLDPGIPEVQDWITSIVAEVVSRYPVDGVQFD-----------
YDDW_ECO57      NASVYVQHRDWIRTSGDR--------FVLDPGIPEVQDWITSIVAEVVSRYPVDGVQFD-----------
NAGAB_CHICK     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMYYAPQAWTSDDTDPIERLKIQ
AGAL1_PEDPE     ALPPERQGEVYHRYVLGLYELLERLTTAYPHILFEGCSGGGGRFDAGMAYYMPQIWASDNTDAVARLTIQ
AGAL_STRMU      RTYLETQMQ-SHAYILGLYNIVSYLTTKHDKVLFESCSGGGGRNDLGMMCYFPQVWSSDNTDAIARLPIQ
AGALC_ASPNG     STD--------HQYMLGLYRVFDTLTTRFPDVLWEGCASGGGRFDAGMLQYVPQIWTSDNTDAIDRITIQ
AGAL2_PEDPE     HLPAAQQGELYHRYVCGLYDILTRLKRACPKLIIENCSAGGGRFDFGMLPYTNQTWISDLTDPVDRATIE
RAFA_ECOLX      ---GHEGRAAADAQTRQFYRLLDLLRERFPHVEFESCASGGGRIDFEVLKRTHRFWASDNNDALERCTIQ
AGAL_SCHPO      ----------------------------------------------------------------------
MEL5_YEAST      ----------------------------------------------------------------------
MEL6_YEAST      ----------------------------------------------------------------------
MEL2_YEAST      ----------------------------------------------------------------------
MEL1_YEAST      ----------------------------------------------------------------------
MEL_ZYGMR       ----------------------------------------------------------------------
MEL_SACPA       ----------------------------------------------------------------------
NAGAB_BOVIN     ----------------------------------------------------------------------
MEL_SACPS       ----------------------------------------------------------------------
AGAL_ORYSJ      ----------------------------------------------------------------------
MEL_ZYGCI       ----------------------------------------------------------------------
MEL_SACMI       ----------------------------------------------------------------------
NAGAB_RAT       ----------------------------------------------------------------------
NAGAB_MOUSE     ----------------------------------------------------------------------
NAGAB_HUMAN     ----------------------------------------------------------------------
AGAL_CYATE      ----------------------------------------------------------------------
AGAL_COFAR      ----------------------------------------------------------------------
MEL_TORDE       ----------------------------------------------------------------------
AGAL_MOUSE      ----------------------------------------------------------------------
AGAL_DICDI      ----------------------------------------------------------------------
AGAL_ASPNG      ----------------------------------------------------------------------
AGAL_HUMAN      ----------------------------------------------------------------------
YDDW_SHIFL      ----------------------------------------------------------------------
YDDW_ECOLI      ----------------------------------------------------------------------
YDDW_ECOL6      ----------------------------------------------------------------------
YDDW_ECO57      ----------------------------------------------------------------------
NAGAB_CHICK     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           HGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFSSFGYELDVTRLSVEEKEQVREQIQFYKKYR
AGAL1_PEDPE     YGTSLAYPISLATAHVSVSPNQQTGRETSMSTRSAVAASGVLGYELDLTQLSSADXXXXXXXXXXXXXXR
AGAL_STRMU      YGSSYLYPTISMGAHVSAVPNHQMNRHTPLTTRGHVAMMGNLGYELDLAILTKNEKKAVANQIKHYKKIR
AGALC_ASPNG     FGTSLAYPPSAMGAHLSAVPNAQTGRTVPFTFRAHVAMMGSFGLELDPA--TVEGDEIVPELLALAEKVN
AGAL2_PEDPE     NGFSYLFPPRIFSNHITASPNAQNGRITPFETRLQLACIGQLGLELNPKQLAPSEQQLLRGALIKYQQLK
RAFA_ECOLX      RGMSYFFPPEVMGAHIGHRRCHATFRQHSIAFRGLTALFGHMGLELDPVAADAKESDGYRRYALLYKEWR
AGAL_SCHPO      ----------------------------------------------------------------------
MEL5_YEAST      ----------------------------------------------------------------------
MEL6_YEAST      ----------------------------------------------------------------------
MEL2_YEAST      ----------------------------------------------------------------------
MEL1_YEAST      ----------------------------------------------------------------------
MEL_ZYGMR       ----------------------------------------------------------------------
MEL_SACPA       ----------------------------------------------------------------------
NAGAB_BOVIN     ----------------------------------------------------------------------
MEL_SACPS       ----------------------------------------------------------------------
AGAL_ORYSJ      ----------------------------------------------------------------------
MEL_ZYGCI       ----------------------------------------------------------------------
MEL_SACMI       ----------------------------------------------------------------------
NAGAB_RAT       ----------------------------------------------------------------------
NAGAB_MOUSE     ----------------------------------------------------------------------
NAGAB_HUMAN     ----------------------------------------------------------------------
AGAL_CYATE      ----------------------------------------------------------------------
AGAL_COFAR      ----------------------------------------------------------------------
MEL_TORDE       ----------------------------------------------------------------------
AGAL_MOUSE      ----------------------------------------------------------------------
AGAL_DICDI      ----------------------------------------------------------------------
AGAL_ASPNG      ----------------------------------------------------------------------
AGAL_HUMAN      ----------------------------------------------------------------------
YDDW_SHIFL      ----------------------------------------------------------------------
YDDW_ECOLI      ----------------------------------------------------------------------
YDDW_ECOL6      ----------------------------------------------------------------------
YDDW_ECO57      ----------------------------------------------------------------------
NAGAB_CHICK     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SLFQYGDFYRINSPFSCDSASWQVVSKDKCQSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSRFDEFF
AGAL1_PEDPE     PLIQFGEFYRLKSPITSNQAAWMFVSPQQDEAIVMVFNLTSYAQPSLTKTKLVGLNPKLNYQNIATKAIF
AGAL_STRMU      SVVQFGKLYRINPEVGINEVAVQYTYDN--QVLVTYVRIQSTIEMMETTVKLRGLDADAIYVLIETGQIF
AGALC_ASPNG     PIILNGDLYRLRLPQDSQWPAALFVSQDGAQAVLFYFQVQPNVNHAVPWVRLQGLDPKADYTVDG-DQTY
AGAL2_PEDPE     STFIKAHFYRL--PTTRHVVAWLIVTADKKQAICCYLNLNSRVKTQHP-LPLHYLDAELAYSDSSGNR-Y
RAFA_ECOLX      QLIHTGVLWRVDMPDSSIQVQ-GVVSPDQSQALFMISQL---AMPDYTLLRFPGLAAEVRYRLRVID---
AGAL_SCHPO      ----------------------------------------------------------------------
MEL5_YEAST      ----------------------------------------------------------------------
MEL6_YEAST      ----------------------------------------------------------------------
MEL2_YEAST      ----------------------------------------------------------------------
MEL1_YEAST      ----------------------------------------------------------------------
MEL_ZYGMR       ----------------------------------------------------------------------
MEL_SACPA       ----------------------------------------------------------------------
NAGAB_BOVIN     ----------------------------------------------------------------------
MEL_SACPS       ----------------------------------------------------------------------
AGAL_ORYSJ      ----------------------------------------------------------------------
MEL_ZYGCI       ----------------------------------------------------------------------
MEL_SACMI       ----------------------------------------------------------------------
NAGAB_RAT       ----------------------------------------------------------------------
NAGAB_MOUSE     ----------------------------------------------------------------------
NAGAB_HUMAN     ----------------------------------------------------------------------
AGAL_CYATE      ----------------------------------------------------------------------
AGAL_COFAR      ----------------------------------------------------------------------
MEL_TORDE       ----------------------------------------------------------------------
AGAL_MOUSE      ----------------------------------------------------------------------
AGAL_DICDI      ----------------------------------------------------------------------
AGAL_ASPNG      ----------------------------------------------------------------------
AGAL_HUMAN      ----------------------------------------------------------------------
YDDW_SHIFL      ----------------------------------------------------------------------
YDDW_ECOLI      ----------------------------------------------------------------------
YDDW_ECOL6      ----------------------------------------------------------------------
YDDW_ECO57      ----------------------------------------------------------------------
NAGAB_CHICK     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           YGDELMNAGIKVSLSNLALCVPEYLTKLFVIExxxxxx
AGAL1_PEDPE     GGDELMQLG-----------------------------
AGAL_STRMU      SGAELMYAGLTIDMPQ-----GDYLSKQY---------
AGALC_ASPNG     SGATLMNLGLQYSFDT------EYGSKVVFLE------
AGAL2_PEDPE     TGHQLNTMGIPLKPTN----------------------
RAFA_ECOLX      --------------------------------------
AGAL_SCHPO      --------------------------------------
MEL5_YEAST      --------------------------------------
MEL6_YEAST      --------------------------------------
MEL2_YEAST      --------------------------------------
MEL1_YEAST      --------------------------------------
MEL_ZYGMR       --------------------------------------
MEL_SACPA       --------------------------------------
NAGAB_BOVIN     --------------------------------------
MEL_SACPS       --------------------------------------
AGAL_ORYSJ      --------------------------------------
MEL_ZYGCI       --------------------------------------
MEL_SACMI       --------------------------------------
NAGAB_RAT       --------------------------------------
NAGAB_MOUSE     --------------------------------------
NAGAB_HUMAN     --------------------------------------
AGAL_CYATE      --------------------------------------
AGAL_COFAR      --------------------------------------
MEL_TORDE       --------------------------------------
AGAL_MOUSE      --------------------------------------
AGAL_DICDI      --------------------------------------
AGAL_ASPNG      --------------------------------------
AGAL_HUMAN      --------------------------------------
YDDW_SHIFL      --------------------------------------
YDDW_ECOLI      --------------------------------------
YDDW_ECOL6      --------------------------------------
YDDW_ECO57      --------------------------------------
NAGAB_CHICK     --------------------------------------