[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF54887.1

[Show Plain Result]


## Summary of Sequence Search
    1::99
    7::85      8e-09  37%   88 aa  Y1229_BACHD RecName: Full=UPF0092 membrane protein BH1229;
    2::85      9e-08  34%   89 aa  YRBF_BACSU RecName: Full=UPF0092 membrane protein yrbF;
   14::92      2e-07  39%  102 aa  Y1254_AQUAE RecName: Full=UPF0092 membrane protein aq_1254;
    5::97      1e-06  29%   97 aa  Y241_HAEIN RecName: Full=UPF0092 membrane protein HI0241;
   31::100     9e-06  29%  141 aa  Y893_RICCN RecName: Full=UPF0092 membrane protein RC0893;
   21::103     3e-05  32%  110 aa  YAJC_SHIFL RecName: Full=UPF0092 membrane protein yajC;
   21::103     3e-05  32%  110 aa  YAJC_ECOLI RecName: Full=UPF0092 membrane protein yajC;
   21::103     3e-05  32%  110 aa  YAJC_ECOL6 RecName: Full=UPF0092 membrane protein yajC;
   21::103     3e-05  32%  110 aa  YAJC_ECO57 RecName: Full=UPF0092 membrane protein yajC;
   23::87      6e-05  33%  111 aa  Y134_BUCAI RecName: Full=UPF0092 membrane protein BU134;
    1::99

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNPNITFLIMLVGMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTEKGTIVLDVD
Y1229_BACHD     ------FLIPLILMFAIFYFXXXXXXXXXXXXXXEMNNLQRGDKIVTIGGLHGTIDSLD-ESTVVILVND
YRBF_BACSU      MTGTLGTLVPIILMFAVLYFLLRPXXXXXXAVRQMQEELKKGDSVVTIGGLHGTVDSIDESK-VVIKTGD
Y1254_AQUAE     -------IIFLVAIFLMFYFLIRPQKKERERHRKFLESLKKGDKVITSSGIWGTVVEIGDR--TITLKVD
Y241_HAEIN      -SPMSTLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKGTEVLTAGGVIGKITKVTEGSDSIVIALD
Y893_RICCN      LQSGLTSLIPMVLIFAVFYFLLRPQETRRKEREKLVSEVKKGEEVLTNSGIYGIVTKVSENDNNIEIEI-
YAJC_SHIFL      ----MSLILMLVVFGLIFYFMLRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKV-AENGYIAIALD
YAJC_ECOLI      ----MSLILMLVVFGLIFYFMLRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKV-AENGYIAIALD
YAJC_ECOL6      ----MSLILMLVVFGLIFYFMLRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKV-AENGYIAIALD
YAJC_ECO57      ----MSLILMLVVFGLIFYFMLRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKV-AENGYIAIALD
Y134_BUCAI      -----SLIFMAVIFLLIFYFMLRPQQKKDKEHKNLINSLVQGDEVITTSGLLGRIKKI-TKNGYILLELN


                         .         .         *         .         .         .         .:140
query           GVYLTFELAAIKTVLPLKETASLxxxxxx
Y1229_BACHD     NRKLTFDRSAIREVV--------------
YRBF_BACSU      NTRLTFDRRAIREV---------------
Y1254_AQUAE     NTKITFSKEAIVAYQP-------------
Y241_HAEIN      TTEITINRNYIVSVLPKGSLKSL------
Y893_RICCN      -----------------------------
YAJC_SHIFL      TTEVVIKRDFVAAVLP-------------
YAJC_ECOLI      TTEVVIKRDFVAAVLP-------------
YAJC_ECOL6      TTEVVIKRDFVAAVLP-------------
YAJC_ECO57      TTEVVIKRDFVAAVLP-------------
Y134_BUCAI      -----------------------------