[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55041.1

[Show Plain Result]


## Summary of Sequence Search
    1::202
   31::201     2e-17  36%  346 aa  Y131_HAEIN RecName: Full=Uncharacterized protein HI0131;Flags:
   51::222     6e-09  30%  358 aa  Y4FP_RHISN RecName: Full=Probable ABC transporter
   33::203     1e-06  26%  338 aa  FBPA_SERMA RecName: Full=Fe(3+)-binding periplasmic
   65::206     3e-05  24%  360 aa  FUTA1_SYNY3 RecName: Full=Iron uptake protein A1;Flags: Precursor;
   57::181     9e-05  30%  360 aa  POTD1_HAEIN RecName: Full=Spermidine/putrescine-binding periplasmic
   25::154     2e-04  22%  332 aa  P5217_PSEAE RecName: Full=Probable binding protein component of ABC
  106::190     2e-04  26%  348 aa  POTD_SHIFL RecName: Full=Spermidine/putrescine-binding periplasmic
  106::190     2e-04  26%  348 aa  POTD_ECOLI RecName: Full=Spermidine/putrescine-binding periplasmic
   46::167     4e-04  25%  346 aa  FUTA2_SYNY3 RecName: Full=Iron uptake protein A2;AltName: Full=Iron
  153::244     4e-04  30%  485 aa  DLTA_STAES RecName: Full=D-alanine--poly(phosphoribitol) ligase
  153::244     4e-04  30%  485 aa  DLTA_STAEQ RecName: Full=D-alanine--poly(phosphoribitol) ligase
    1::202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVVYSPNSEGLIGATIPAFEEKYGIKIELIQAGTGELFKKL
Y131_HAEIN      -----------------------------LVVYCSATNILCETTTKAFGEKYDVKTSFIRNGSGSTFAKV
Y4FP_RHISN      -------------------------------VYSPQG-GERGAWIAEQAKAAGHEIKLLNAGGGELYDRL
FBPA_SERMA      -----------------------------IVIYNAQHENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQL
FUTA1_SYNY3     -----------------------------------------------FTAETGIKVNLIEGKADELLERI
POTD1_HAEIN     -----------------------------------------------FTKETGIKVIVSSLESNEMYAKL
P5217_PSEAE     -----------------------------VVVYSSRIDELIKPVFDAYTSKTGVKVKFITDKEAPLMARI
POTD_SHIFL      ----------------------------------------------------------------------
POTD_ECOLI      ----------------------------------------------------------------------
FUTA2_SYNY3     -------------------------------------------TDDALYDAFG-EVNLIEASAEELIERI
DLTA_STAES      ----------------------------------------------------------------------
DLTA_STAEQ      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESEKEVPVADVIFGGSYTQYATHGELFENYISKENDNVIKEYQNTTGFSTPYTLDGSVLIVHPDLTKGMN
Y131_HAEIN      EAEKNNPQADVWFGGTFDPQAQAAELIEPYKSKHIDEIVERFREPAKTKGHYVSS----IYMGILGFGVN
Y4FP_RHISN      IAEENNPQADVVLGMVDTSMALLKKLFQPYSPSWAKDLPAQYKDAEGLVHKFWQTPIVLAYYPDLADPDA
FBPA_SERMA      VQEGSASPADVFLNSPAMVLVDNAKLFAPLDAATLAQVEPQYRPSHGRWIGIAARSTVFVYNPKLSDAQL
FUTA1_SYNY3     KSEGANSPADVLLTVDLARLAEEDGIFQPVQSEILETNVPEYRSPDGMWFGFTKRARVIMYNKGKVKPEE
POTD1_HAEIN     KTQGESGGYDVIAPSNYSKMAREGMLKELDHSKDPDWLNKPYDKGNKYSLPQLLGAPGIAFNTNTYKGEQ
P5217_PSEAE     KAEGANTPADLLLAGNLWQAEQMGLLQPFKSATIERNIPSQYRSSTDSWTGLSLRARTIVYSTERVKPEE
POTD_SHIFL      ----------------------------NFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGVNGDAVDPKS
POTD_ECOLI      ----------------------------NFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGVNGDAVDPKS
FUTA2_SYNY3     QSEGANSPGDILFDAGMLWRAEQAGLFQPVRSKLNERIPENLRHPDGLWYGFTQRARVLYYSRDRVNPAD
DLTA_STAES      --------------GVQIEYASLNEFAEWMVSLNKTGTGKEWLN----QAPFSFDLSVMAIYPCLTSGLN
DLTA_STAEQ      --------------GVQIEYASLNEFAEWMVSLNKTGTGKEWLN----QAPFSFDLSVMAIYPCLTSGLN


                         +         .         .         .         .         *         .:210
query           IEGYSDLLKPELKGKIATADPANSSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGIVx
Y131_HAEIN      TERWKDLTDPRLKGEVQIADPQSAGTAYTALATFVQLWG---EKEAFDFLKEL---------
Y4FP_RHISN      PKSWLDLTKDDYEGKYVIGSTAAQTTRMGILVRFLDADGEVSDE-GWDFLDRFYA--EGII-
FBPA_SERMA      PKSLLDLAKPEWKGRWAASP---SGADFQAIVSALLELKGEKATLAWKAMKTNFTAYKG---
FUTA1_SYNY3     LSTYEELADPKWKGRVIIRSSSNEYN--QSLVASLVVADGEESTLAWA--------------
POTD1_HAEIN     FTSWADLWKPEFANKVQLLDDA----------------------------------------
P5217_PSEAE     LSTYEALADKQWEGRL----------------------------------------------
POTD_SHIFL      VTSWADLWKPEYKGSLLLTDDAR--EVFQMALRKLGYSGNTTDPK-----------------
POTD_ECOLI      VTSWADLWKPEYKGSLLLTDDAR--EVFQMALRKLGYSGNTTDPK-----------------
FUTA2_SYNY3     LSTYEALADPQWRGKILVRPSSN---------------------------------------
DLTA_STAES      LVDKDMIKKPKLLNEMLVQTPMNSTPSFIEMCLLL---------------------------
DLTA_STAEQ      LVDKDMIKKPKLLNEMLVQTPMNSTPSFIEMCLLL---------------------------