[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55075.1

[Show Plain Result]


## Summary of Sequence Search
    1::145
    2::129     9e-28  46%  133 aa  YWNA_BACSU RecName: Full=Putative HTH-type transcriptional
    1::100     2e-07  31%  150 aa  RRF2_DESVH RecName: Full=Protein rrf2;
    1::140     9e-07  27%  156 aa  YFFB_LACLA RecName: Full=Putative HTH-type transcriptional
   27::91      2e-06  41%  156 aa  YWGB_BACSU RecName: Full=Putative HTH-type transcriptional
    1::123     1e-05  26%  154 aa  AAU3_RHIME RecName: Full=Protein aau3;
    1::97      4e-05  29%  164 aa  ISCR_PHOLL RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      6e-05  29%  164 aa  ISCR_SERP5 RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      8e-05  29%  164 aa  ISCR_XENNE RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      1e-04  28%  165 aa  ISCR_EDWI9 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_SHISS RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_SHIFL RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_SHIF8 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_SHIDS RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_SHIBS RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_SHIB3 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  172 aa  ISCR_PHOPR RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  163 aa  ISCR_KLEP3 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ESCF3 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOUT RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOSM RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOSE RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOLU RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOLI RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOLC RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOL6 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOL5 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOK1 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOHS RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECODH RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECOBW RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECO8A RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECO81 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECO7I RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECO5E RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECO57 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECO55 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECO45 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECO27 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      2e-04  27%  162 aa  ISCR_ECO24 RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      2e-04  27%  168 aa  ISCR_ALISL RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      3e-04  27%  173 aa  ISCR_VIBSL RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      4e-04  28%  164 aa  ISCR_YERPS RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      4e-04  28%  164 aa  ISCR_YERPP RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      4e-04  28%  164 aa  ISCR_YERPN RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      4e-04  28%  164 aa  ISCR_YERPG RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      4e-04  28%  164 aa  ISCR_YERPE RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      4e-04  28%  164 aa  ISCR_YERPA RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      4e-04  28%  164 aa  ISCR_YERP3 RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      4e-04  28%  164 aa  ISCR_YERE8 RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      4e-04  28%  165 aa  ISCR_SODGM RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALTY RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALTI RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALSV RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALPK RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALPC RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALPB RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALPA RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALNS RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALHS RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALG2 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALEP RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALDC RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALCH RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALAR RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  164 aa  ISCR_SALA4 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  163 aa  ISCR_KLEP7 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  163 aa  ISCR_ENT38 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      4e-04  27%  163 aa  ISCR_CITK8 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      5e-04  28%  168 aa  ISCR_VIBVY RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      5e-04  28%  168 aa  ISCR_VIBVU RecName: Full=HTH-type transcriptional regulator iscR;
    1::97      7e-04  27%  164 aa  ISCR_PECCP RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      7e-04  25%  162 aa  ISCR_ENTS8 RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      0.001  25%  168 aa  ISCR_VIBPA RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      0.001  25%  168 aa  ISCR_VIBHB RecName: Full=HTH-type transcriptional regulator iscR;
    1::84      0.001  25%  164 aa  ISCR_ERWCT RecName: Full=HTH-type transcriptional regulator iscR;
    1::145

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGTEIVKDL
YWNA_BACSU      --INSRLAVAIHILSLISMDEKTS---SEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPGASLKKDP
RRF2_DESVH      MKLTTRSRYGTRMLLDIAMHGSEQPVSIKDIAQRQGISVKYLEKLIRVLRKAGYITSTLGAGGYQLAHKA
YFFB_LACLA      MKLSSGWEQSVYVLLILARLPENRTMSSIALANRLKVSPSYLKKIIKSLVDEGLLRSTPGNGGFSLNKEL
YWGB_BACSU      --------------------------TSEAISQRLRVSPSYLKKLMRTLVQAGLAESLPGTGGFTLTKPL
AAU3_RHIME      MRLTKQTNYAVRMLMYCAANGEKLSRIPE-IARAYGVSELFLFKILQPLTRAGLVETVRGNGGVRLPRPA
ISCR_PHOLL      MRLTSKGRYAVTAMLDVALHSQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SERP5      MRLTSKGRYAVTAMLDVALHSQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_XENNE      MRLTSKGRYAVTAMLDVALHSQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLRDA
ISCR_EDWI9      MRLTSKGRYAVTAMLDVALHSQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKET
ISCR_SHISS      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SHIFL      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SHIF8      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SHIDS      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SHIBS      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SHIB3      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_PHOPR      MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQLFSRLRKAGLVASVRGPGGYRLGEDA
ISCR_KLEP3      MRLTSKGRYAVTAMLDVALNSETGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ESCF3      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOUT      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOSM      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOSE      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOLU      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOLI      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOLC      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOL6      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOL5      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOK1      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOHS      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECODH      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECOBW      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECO8A      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECO81      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECO7I      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECO5E      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECO57      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECO55      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECO45      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECO27      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ECO24      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ALISL      MKLTSKGRYAVTAMLDVALHAQEGPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGDEIAVGM
ISCR_VIBSL      MKLTSKGRYAVTAMLDVALHSQKSPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGYRLGAEA
ISCR_YERPS      MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_YERPP      MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_YERPN      MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_YERPG      MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_YERPE      MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_YERPA      MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_YERP3      MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_YERE8      MRLTSKGRYAVTAMLDVALHSQDGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_SODGM      MRLTSKGRYAVTAMLDVALHSGKGPVPLAEISERQGISLSYLEQLFSRLRKHELVASVRGPGGGYLLRDS
ISCR_SALTY      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALTI      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALSV      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALPK      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALPC      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALPB      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALPA      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALNS      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALHS      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALG2      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALEP      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALDC      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALCH      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALAR      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_SALA4      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_KLEP7      MRLTSKGRYAVTAMLDVALNSETGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_ENT38      MRLTSKGRYAVTAMLDVALNSETGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_CITK8      MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRGPGGGYLLKDA
ISCR_VIBVY      MKLTSKGRYAVTAMLDVALHSQKSPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGYRLGADA
ISCR_VIBVU      MKLTSKGRYAVTAMLDVALHSQKSPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGYRLGADA
ISCR_PECCP      MRLTSKGRYAVTAMLDVALHSQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKSA
ISCR_ENTS8      MRLTSKGRYAVTAMLDVALNSESGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKDA
ISCR_VIBPA      MKLTSKGRYAVTAMLDVALHSQQNPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGYRLGADA
ISCR_VIBHB      MKLTSKGRYAVTAMLDVALHSQQNPVPLADISERQGISLSYLEQLFSKLRKAGLVASVRGPGGYRLGADA
ISCR_ERWCT      MRLTSKGRYAVTAMLDVALHSQEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRGPGGGYLLKNA


                         .         .         *         .         .         .         .:140
query           KDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQLTMEAELGQTSLEKVVADAE
YWNA_BACSU      ADISLLEVYRAVQ---KQEELFAVHENPNPKCPVGKKIQNALDETFESVQRAMENELASKSLKDVM----
RRF2_DESVH      EDIPVGDVVYALEEMEAPVEC----DEENPCCP-------------------------------------
YFFB_LACLA      HDISFYDVFLAIEGRGRIFQSQGLLQN-FIGSESGKAKRCAITSALDEIENTLVRTLSNVSLAQVADETQ
YWGB_BACSU      ADITLYDVYQAVEGRGSMYQ--------------------------------------------------
AAU3_RHIME      SEITLFDVVKVTEDSFAMAECFEAGEIDCPSCGLNAALRKALNAFFEVLQ--------------------
ISCR_PHOLL      SEIVVAEVIFAVDCQGREG---------------------------------------------------
ISCR_SERP5      SEIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_XENNE      GRIFVAEVISAVDCQGKEG---------------------------------------------------
ISCR_EDWI9      SEIAIGAVITAVDCQGKEG---------------------------------------------------
ISCR_SHISS      SSIAVGEVISAVD---------------------------------------------------------
ISCR_SHIFL      SSIAVGEVISAVD---------------------------------------------------------
ISCR_SHIF8      SSIAVGEVISAVD---------------------------------------------------------
ISCR_SHIDS      SSIAVGEVISAVD---------------------------------------------------------
ISCR_SHIBS      SSIAVGEVISAVD---------------------------------------------------------
ISCR_SHIB3      SSIAVGEVISAVD---------------------------------------------------------
ISCR_PHOPR      NDIAVGMVIAAVD---------------------------------------------------------
ISCR_KLEP3      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ESCF3      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOUT      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOSM      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOSE      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOLU      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOLI      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOLC      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOL6      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOL5      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOK1      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOHS      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECODH      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECOBW      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECO8A      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECO81      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECO7I      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECO5E      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECO57      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECO55      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECO45      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECO27      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ECO24      SSIAVGEVISAVD---------------------------------------------------------
ISCR_ALISL      VISAVDESVDATKCHGKEG---------------------------------------------------
ISCR_VIBSL      SDIAVGTVIAAVD---------------------------------------------------------
ISCR_YERPS      SAIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_YERPP      SAIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_YERPN      SAIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_YERPG      SAIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_YERPE      SAIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_YERPA      SAIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_YERP3      SAIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_YERE8      SAIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_SODGM      DQIAVGAVITAVDCQGKEG---------------------------------------------------
ISCR_SALTY      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALTI      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALSV      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALPK      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALPC      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALPB      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALPA      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALNS      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALHS      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALG2      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALEP      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALDC      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALCH      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALAR      GSIAVGEVISAVD---------------------------------------------------------
ISCR_SALA4      GSIAVGEVISAVD---------------------------------------------------------
ISCR_KLEP7      GSIAVGEVISAVD---------------------------------------------------------
ISCR_ENT38      GSIAVGEVISAVD---------------------------------------------------------
ISCR_CITK8      GSIAVGEVISAVD---------------------------------------------------------
ISCR_VIBVY      FTISIGTVIAAVD---------------------------------------------------------
ISCR_VIBVU      FTISIGTVIAAVD---------------------------------------------------------
ISCR_PECCP      NEIAVGMVISAVDCQGREG---------------------------------------------------
ISCR_ENTS8      GQIAVGEVISAVD---------------------------------------------------------
ISCR_VIBPA      HSIAIGTVIAAVD---------------------------------------------------------
ISCR_VIBHB      HSIAIGTVIAAVD---------------------------------------------------------
ISCR_ERWCT      NEIAVGMVISAVD---------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxx
YWNA_BACSU      -----
RRF2_DESVH      -----
YFFB_LACLA      -----
YWGB_BACSU      -----
AAU3_RHIME      -----
ISCR_PHOLL      -----
ISCR_SERP5      -----
ISCR_XENNE      -----
ISCR_EDWI9      -----
ISCR_SHISS      -----
ISCR_SHIFL      -----
ISCR_SHIF8      -----
ISCR_SHIDS      -----
ISCR_SHIBS      -----
ISCR_SHIB3      -----
ISCR_PHOPR      -----
ISCR_KLEP3      -----
ISCR_ESCF3      -----
ISCR_ECOUT      -----
ISCR_ECOSM      -----
ISCR_ECOSE      -----
ISCR_ECOLU      -----
ISCR_ECOLI      -----
ISCR_ECOLC      -----
ISCR_ECOL6      -----
ISCR_ECOL5      -----
ISCR_ECOK1      -----
ISCR_ECOHS      -----
ISCR_ECODH      -----
ISCR_ECOBW      -----
ISCR_ECO8A      -----
ISCR_ECO81      -----
ISCR_ECO7I      -----
ISCR_ECO5E      -----
ISCR_ECO57      -----
ISCR_ECO55      -----
ISCR_ECO45      -----
ISCR_ECO27      -----
ISCR_ECO24      -----
ISCR_ALISL      -----
ISCR_VIBSL      -----
ISCR_YERPS      -----
ISCR_YERPP      -----
ISCR_YERPN      -----
ISCR_YERPG      -----
ISCR_YERPE      -----
ISCR_YERPA      -----
ISCR_YERP3      -----
ISCR_YERE8      -----
ISCR_SODGM      -----
ISCR_SALTY      -----
ISCR_SALTI      -----
ISCR_SALSV      -----
ISCR_SALPK      -----
ISCR_SALPC      -----
ISCR_SALPB      -----
ISCR_SALPA      -----
ISCR_SALNS      -----
ISCR_SALHS      -----
ISCR_SALG2      -----
ISCR_SALEP      -----
ISCR_SALDC      -----
ISCR_SALCH      -----
ISCR_SALAR      -----
ISCR_SALA4      -----
ISCR_KLEP7      -----
ISCR_ENT38      -----
ISCR_CITK8      -----
ISCR_VIBVY      -----
ISCR_VIBVU      -----
ISCR_PECCP      -----
ISCR_ENTS8      -----
ISCR_VIBPA      -----
ISCR_VIBHB      -----
ISCR_ERWCT      -----