[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55106.1

[Show Plain Result]


## Summary of Sequence Search
    1::440
   23::429     3e-67  36%  430 aa  FOLC_BACSU RecName: Full=Folylpolyglutamate synthase;       
   24::428     2e-57  35%  428 aa  FOLC_LACCA RecName: Full=Folylpolyglutamate synthase;       
    6::417     2e-47  34%  427 aa  FOLD_YEAST RecName: Full=Folylpolyglutamate synthase;       
    6::413     5e-45  35%  417 aa  FOLD_SCHPO RecName: Full=Probable folylpolyglutamate synthase;     
   88::484     2e-40  32%  510 aa  FOLC_CAEEL RecName: Full=Putative folylpolyglutamate synthase;     
   65::387     2e-37  36%  587 aa  FOLC_MOUSE RecName: Full=Folylpolyglutamate synthase,
   78::356     4e-37  36%  505 aa  FOLE_SCHPO RecName: Full=Probable folylpolyglutamate synthase;     
   65::387     1e-36  36%  587 aa  FOLC_CRIGR RecName: Full=Folylpolyglutamate synthase,
   92::385     3e-36  37%  585 aa  FOLC_BOVIN RecName: Full=Folylpolyglutamate synthase,
   95::387     4e-35  35%  587 aa  FOLC_HUMAN RecName: Full=Folylpolyglutamate synthase,
   19::313     1e-34  34%  422 aa  FOLC_ECOLI RecName: Full=Bifunctional protein folC;Includes:
   71::365     4e-34  34%  514 aa  FOLE_CANAL RecName: Full=Folylpolyglutamate synthase;       
  119::426     5e-32  35%  548 aa  FOLE_YEAST RecName: Full=Folylpolyglutamate synthase;       
   40::340     8e-32  34%  418 aa  FOLC_BUCAP RecName: Full=Bifunctional protein folC;Includes:
   93::374     3e-31  36%  528 aa  FOLE_NEUCR RecName: Full=Folylpolyglutamate synthase;       
   30::327     7e-31  35%  437 aa  FOLC_HAEIN RecName: Full=Folylpolyglutamate synthase;       
  136::356     1e-30  40%  626 aa  FOLC_DICDI RecName: Full=Putative folylpolyglutamate synthase;     
   47::370     2e-29  30%  426 aa  FOLC_BUCBP RecName: Full=Bifunctional protein folC;Includes:
   45::303     3e-22  31%  411 aa  FOLC_BUCAI RecName: Full=Bifunctional protein folC;Includes:
   10::280     3e-16  32%  430 aa  FOLC_YEAST RecName: Full=Probable folylpolyglutamate synthase;     
   97::359     1e-08  27%  482 aa  MURE_THETN RecName:
   93::368     3e-08  26%  494 aa  MURE_BACSU RecName:
   97::376     5e-08  32%  483 aa  MURE_CHLTR RecName:
   97::376     5e-08  32%  483 aa  MURE_CHLTA RecName:
  173::376     6e-08  31%  483 aa  MURE_CHLCV RecName:
   98::362     1e-07  31%  482 aa  MURE1_CLOAB RecName:
  217::357     5e-06  34%  444 aa  MURC_LACSS RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  100::455     6e-06  26%  485 aa  MURE_CLOTE RecName:
   93::305     1e-05  26%  488 aa  MURE_BACLD RecName:
  218::384     2e-05  34%  443 aa  MURC_LACBA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  127::387     3e-05  32%  514 aa  MURE_LEIXX RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
  107::434     3e-05  24%  508 aa  MURE_BORBU RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
   98::375     3e-05  27%  487 aa  MURE_ALKOO RecName:
  179::412     3e-05  26%  469 aa  MURC_RUTMC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
   67::140     4e-05  34%  489 aa  MURE_COXBU RecName:
  339::407     7e-05  40%  535 aa  MURE_MYCTU RecName:
  339::407     7e-05  40%  535 aa  MURE_MYCBO RecName:
  279::356     9e-05  36%  482 aa  MURE_AQUAE RecName:
  217::377     1e-04  30%  437 aa  MURC_LYSSC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  189::389     3e-04  26%  479 aa  MURC_PSYA2 RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  160::238     4e-04  34%  459 aa  MURF_TREPA RecName:
  220::356     4e-04  32%  436 aa  MURC_PEDPA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  221::423     4e-04  26%  437 aa  MURC_LACAC RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  221::423     6e-04  25%  437 aa  MURC_LACGA RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  103::175     7e-04  40%  540 aa  MURE_TREPA RecName: Full=UDP-N-acetylmuramyl-tripeptide synthetase;
  302::381     7e-04  35%  509 aa  MURE_PROM1 RecName:
   98::138     7e-04  39%  486 aa  MURE_PARD8 RecName:
  318::404     7e-04  36%  530 aa  MURE_MYCLE RecName:
  218::356     7e-04  37%  436 aa  MURC_LACPL RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  221::423     7e-04  25%  437 aa  MURC_LACJO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase;   
  106::366     0.001  28%  481 aa  MURE_STRTD RecName:
  106::366     0.001  28%  481 aa  MURE_STRT2 RecName:
  106::366     0.001  28%  481 aa  MURE_STRT1 RecName:
    1::440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIGGTNGKGSTIAFLKKMLEKLGLRVGV
FOLC_BACSU      --------------------GLGRMKQLMARLGHPEKKIRAFHVAGTNGKGSTVAFIRSMLQEAGYTVGT
FOLC_LACCA      -----------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGL
FOLD_YEAST      --------------------GLSRITKLLEHLGNPQNSLRVLHIAGTNGKGSVCTYLSSVLQQKSYQIGK
FOLD_SCHPO      --------------------GLQRMLQLLKHLGNPQESFCAVQIAGTNGKGSICSYIYTSLLQAAIKTGR
FOLC_CAEEL      --------------------------------------LNIIHVSGTKGKGSACAFVESILRSQGLRTGF
FOLC_MOUSE      ---------VKRQRSD-PQAQLEAMEMYLARSGEDLNRLNIIHVTGTKGKGSTCAFTERILRNYGLKTGF
FOLE_SCHPO      -------------------------------------RLNVIHVAGTKGKGSTCAFTSSILQQIGERIGM
FOLC_CRIGR      ---------VKRQRSD-PQAQLEAMEVYLARSGEDLNQLNIIHVTGTKGKGSTCAFTERILRSYGLKTGF
FOLC_BOVIN      -------------------------------------QLNIIHITGTKGKGSTCAFTERILRSYGLKTGF
FOLC_HUMAN      -------------------------------------RLNIIHVTGTKGKGSTCAFTECILRSYGLKTGF
FOLC_ECOLI      --------YLENLHSKTIDLGLERVSLVAARLGVLKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGV
FOLE_CANAL      -------------------------------------KLNIIHITGTKGKGSTCAFTESILKQYTIKIGL
FOLE_YEAST      -------------------------------------KLNIVHITGTKGKGSTAAFTSSILEQLP-RIGL
FOLC_BUCAP      -----------------------------------NLKSFFFTVGGTNGKGTTCAMLEKLLLDSGYQVGL
FOLE_NEUCR      -------------------------------------RLNIVHVAGTKGKGGTCAFVDSILTRIPRRIGL
FOLC_HAEIN      --------------------GLDRIKSVAEKLDLLHPVPYVITVGGTNGKGTTCRLLETILLNHGLRVGV
FOLC_DICDI      ----------------------------------------IIHVAGTKGKGSTCAITESIIREQGFSTGL
FOLC_BUCBP      -------------------------------------KAFVFIVGGTNGKGSTCHVLENLLLNSGYRVGL
FOLC_BUCAI      ----------------------------------------IFTVAGTNGKGTTCAVLERLLLDSGYQVGL
FOLC_YEAST      ---------------------LPRINRLLEHVGNPQDSLSILHIAGTNGKETVSKFLTSILQHPGVLIGR
MURE_THETN      ---------------------------------NPTSKLTLIGITGTNGKTSVTYMLKAILEQQNNKVG-
MURE_BACSU      -----------------------------AFYGQPTKKLQLIGITGTNGKTSTTHMVDEILKKAGKRTGL
MURE_CHLTR      ---------------------------------NPSRHLDVIGITGTNGKTTVSCLVRELMERSGRRTGL
MURE_CHLTA      ---------------------------------NPSRHLDVIGITGTNGKTTVSCLVRELMERSGRRTGL
MURE_CHLCV      ----------------------------------------------------------------------
MURE1_CLOAB     ---------------------------------NPSHKLKLIGITGTNGKTTSTYMMKSMLESSGYKVGL
MURC_LACSS      ----------------------------------------------------------------------
MURE_CLOTE      --------------------------------GNPKDKLKLIGVTGTNGKTTSTFMIKSILEEAGFKVGL
MURE_BACLD      -----------------------------AFYGQPTKQLRLIGITGTNGKTSTSHMVEEIFRKAGSRTGL
MURC_LACBA      ----------------------------------------------------------------------
MURE_LEIXX      -------------------------------------------VTGTNGKTSVVYLLYAILGQLGIVAGL
MURE_BORBU      ----------------------------------PSKKLKVIGVTGTDGKSSVCYYIYLLFKKKGVKVGF
MURE_ALKOO      ----------------------------------PTNTLKLVGVTGTNGKTSITYMVKSILGYYNINVGL
MURC_RUTMC      ----------------------------------------------------------------------
MURE_COXBU      ----EANQYNPSIQTKVPLIPFERIGEIAAFYDDPSCEMEIIGITGTNGKTSCAQFIAQALQSQGIRCGV
MURE_MYCTU      ----------------------------------------------------------------------
MURE_MYCBO      ----------------------------------------------------------------------
MURE_AQUAE      ----------------------------------------------------------------------
MURC_LYSSC      ----------------------------------------------------------------------
MURC_PSYA2      ----------------------------------------------------------------------
MURF_TREPA      ----------------------------------------------------------------------
MURC_PEDPA      ----------------------------------------------------------------------
MURC_LACAC      ----------------------------------------------------------------------
MURC_LACGA      ----------------------------------------------------------------------
MURE_TREPA      ----------------------------------PTRALTVIGVTGTEGKSSTVSFIAQLLRLCGKRVGF
MURE_PROM1      ----------------------------------------------------------------------
MURE_PARD8      --------------------------------GDPSRKLMLVGVTGTNGKTTIATLLYEMFRKMGHKVGL
MURE_MYCLE      ----------------------------------------------------------------------
MURC_LACPL      ----------------------------------------------------------------------
MURC_LACJO      ----------------------------------------------------------------------
MURE_STRTD      ---------------------------------HPQDKLKLLAFTGTKGKTTASYFAFNILKQS------
MURE_STRT2      ---------------------------------HPQDKLKLLAFTGTKGKTTASYFAFNILKQS------
MURE_STRT1      ---------------------------------HPQDKLKLLAFTGTKGKTTASYFAFNILKQS------


                         .         .         *         .         .         .         .:140
query           FSSPYLIHYTDQISINGESISEARLEALMADYQSLLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAI
FOLC_BACSU      FTSPYIITFNERISVNGIPISDEEWTALVNQMKPHVEALDQTEYGQPTEFEIMTACAFLYFAEHKVDFVI
FOLC_LACCA      YTSPFIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXADNVTEFEFITALGYWYFRQRQVDVAV
FOLD_YEAST      FTTPHLVHVTDSITINNKPIPLERYQNIRLQLEALNKSHSLK----CTEFELLTCTAFKYFYDVQCQWCV
FOLD_SCHPO      YTSPHFLEPRDTISINGQIASE---EIFNTCWKQVIEVDRRFRTK-ATEFELLTATAFQCFHHSGVRVAV
FOLC_CAEEL      YSSPHLVHVRERIQVDGQPVSEQMFAEEFFHVYDIIKREHSDNM--PAYFKFLTLLAFRIFVKLNVQVMI
FOLC_MOUSE      FRSPHMVQVRDRIRINGKPISELFTKHFWCLYNQLEEFKDDSHVSMPSYFRFLTLMAFHVFLQEKVDLAV
FOLE_SCHPO      YTSPHLRSVCERIQLNGKPISQELFTKYFFDVWERLENAVGSDSEKPMYFRFLTLMAWHVFISENVDAAI
FOLC_CRIGR      FSSPHLVQVRERIRINGKPISELFTKHFWRLYHQLEEFKDDSHVAMPAYFRFLTLMAFHVFLQEKVDLAV
FOLC_BOVIN      FSSPHLVQVRERIRINGQPISSKHFWRLYHRLEETKDDSSCVSMPG--YFRFLTLMAFHVFLQEKVDLAV
FOLC_HUMAN      FSSPHLVQVRERIRINGQPISELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAV
FOLC_ECOLI      YSSPHLVRYTERVRVQGQELPESAHTASFAEIESA-RGDI-----SLTYFEYGTLSALWLFKQAQLDVVI
FOLE_CANAL      YTSPHLKSVRERIRINGQPINQEKFAKYFFEVWDKFDPQECPTLQPCDQFKYLTILSFHVFLQEGVDTAI
FOLE_YEAST      YTSPHLKSVRERIRINGEPISEEKFAKYFFEVWDRLDSTTSSMIPGSKPFKFLTLLSFHTFIQEDCKSCV
FOLC_BUCAP      YTSPHLINYSERIKVNGLYLSEKD------HIFSFLIIDAEKGNVSLTYFEFITLSALFLFSQYSLDIII
FOLE_NEUCR      FTSPHLIAVRERIRIDSKPISEELFARYFFEVWDRLETSQLAKDEGSKPIRYLTLMSYHVYLSEGVDVAI
FOLC_HAEIN      YSSPHLLRYNERVRIQNQDLPD---EAHTASFAFIDENKT----ESLTYFEFSTLSALHLFKQAKLDVVI
FOLC_DICDI      FTSPHLISPRERIRINGEMISKEMFDLLIKDYQTQL----------PNFFRYLTLMALKIFQDEAIQCTI
FOLC_BUCBP      YTSPHLMRYTERVRINGFELEHLYHISAFNDVKYFQNDVLL------TRFEFITLSALILFKSYNLDIII
FOLC_BUCAI      YTSPHLINFVERVRINGFVLHE---EEHIDSFQNV---ELVRNGVLLTYFEFITLAALILFKRYSLDCII
FOLC_YEAST      YTTSSLLNAKEEISINNEAISLIEYSRI---EKELIEADSSLKLQ-CNNLELLTSVALVYFAKKNCQWCI
MURE_THETN      ---------------------------LVGTIQNMI-GDRVIPTTHTTPESLDLQELFSLMVNEGVKYVV
MURE_BACSU      IGTMY-----------------------------MKIGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAI
MURE_CHLTR      IGT---------------------IEHILG------ENRIIDSF--TTPDAILLQKYFAEMVKQNLSAAV
MURE_CHLTA      IGT---------------------IEHILG------ENRIIDSF--TTPDAILLQKYFAEMVKQNLSAAV
MURE_CHLCV      --------------------------------------------------------------------AV
MURE1_CLOAB     IGT--IANY----------IGDKKIESHRTTPESL-------ELQ-----KLFSDMVHD-----KIDYCV
MURC_LACSS      ----------------------------------------------------------------------
MURE_CLOTE      MGT--ILNYI---------------------------GDRKIYAQRTTPESLEIHKLFKDMVDSGVDYCV
MURE_BACLD      IGTMY------------TKIHDETFEA-----------------KNTTPESVTLQKTFRKMVDQGVDTAV
MURC_LACBA      ----------------------------------------------------------------------
MURE_LEIXX      TSTAERRIGEHAITSTLTTPEATELHALLARMRE--EGVRAAAIEVSAQ-----ALSRHRVDGIEFDVA-
MURE_BORBU      ISTVFFDDGSGSLIKNPYRQSTPESTEIHSFLSTMVKNEAYAILESTSDLETARLIDVNYFA--------
MURE_ALKOO      ------------IGTISNWIGNKEIEAVRTTPES-LELQKILN----------------EMVEQKVDTCV
MURC_RUTMC      ----------------------------------------------------------------------
MURE_COXBU      IGT-------------------------------------------------------------------
MURE_MYCTU      ----------------------------------------------------------------------
MURE_MYCBO      ----------------------------------------------------------------------
MURE_AQUAE      ----------------------------------------------------------------------
MURC_LYSSC      ----------------------------------------------------------------------
MURC_PSYA2      ----------------------------------------------------------------------
MURF_TREPA      -----------------------------------------------------------FFVRAEHEVGI
MURC_PEDPA      ----------------------------------------------------------------------
MURC_LACAC      ----------------------------------------------------------------------
MURC_LACGA      ----------------------------------------------------------------------
MURE_TREPA      IST---VEYSDDILPNAESLTVQRLLAEMREH--------------------------------------
MURE_PROM1      ----------------------------------------------------------------------
MURE_PARD8      LST-------------------------------------------------------------------
MURE_MYCLE      ----------------------------------------------------------------------
MURC_LACPL      ----------------------------------------------------------------------
MURC_LACJO      ----------------------------------------------------------------------
MURE_STRTD      -HKPAMLS-TMNTTLDGKTFFKSNLTTPESLDLFRMMAEAVSN--GMTH--LIMEVSSQAYLTKRVYGLT
MURE_STRT2      -HKPAMLS-TMNTTLDGKTFFKSNLTTPESLDLFRMMAEAVSN--GMTH--LIMEVSSQAYLTKRVYGLT
MURE_STRT1      -HKPAMLS-TMNTTLDGKTFFKSNLTTPESLDLFRMMAEAVSN--GMTH--LIMEVSSQAYLTKRVYGLT


                         +         .         .         .         .         *         .:210
query           MEVGMGGLLDSTNVCQPILTGITTIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALTVIDRI
FOLC_BACSU      FETGLGGRFDSTNVVEPLLTVITSIGHDHMNILGNTXXXXXXXXXXXXXXXXPIVTAVTQPEALQVIRHE
FOLC_LACCA      IEVGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPDXXXXXXXX
FOLD_YEAST      IEVGLGGRLDATNVANKACCGITKISLDHESFLGNTLSEISKEKAGIITEGVPFTVIDGTNEA-SVINVV
FOLD_SCHPO      IETGMGGRLDATNVFEPVLSIISRICLDHQAFLGNTLEAIAKEKAGIFKKNVPVVDGLNEVNVLNQLKLS
FOLC_CAEEL      LEVGIGGEYDCTNVVEPKVCGVTTLDYDHMSILGNKLSEIAWHKAGIFKESVPAFYSPTTTEAEEVLIAR
FOLC_MOUSE      VEVGIGGAFDCTNIIKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKPGVPAFT-VVQPEGPLAVLRD
FOLE_SCHPO      IEVGIGGEYDSTNLIEPYATAVTSLGLDHTSLLGNTIAEIAWQKAGIYKESAIALTCEQAPEAMNVLKNR
FOLC_CRIGR      VEVGIGGAYDCTNIIKPVVCGVSSLGMDHTSLLGDTVEKIAWQKGGIFKPGVPAFTVLQPEGPLAVLRDR
FOLC_BOVIN      LEVGIGGAYDCTNIIKPVVCGITSLGIDHTGLLGDTMEKIAWQKGGIFKSGVPAFTVLQPDEPLAVLRDR
FOLC_HUMAN      VEVGIGGAYDCTNIIKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKQGVPAFTVLQPEGPLAVLRDR
FOLC_ECOLI      LEVGLGGRLDATNIVDADVAVVTSIALDHTDWLGPDRESIGREKAGIFRSEKPAIVGE--PEMPSTIADV
FOLE_CANAL      YEVGVGGTYDSTNIIKPTVTGISALGIDHTFMLGNNIASITENKTGIFKKGVPAFVSRQLPETHELIEKR
FOLE_YEAST      YEVGVGGELDSTNIIEPIVCGVTLLGIDHTFMLGDTIEEIAWNKGGIFKSGAPAFTEKQPPQGLTILKER
FOLC_BUCAP      LEVGLGGRLDATNIIDSDLSVITNIGIDHTSCLGTDRISIGREKSGIFRKGKIAVIGE--KNIPISVDEI
FOLE_NEUCR      YETGIGGEYDATNVVRPVVSGISTLGIDHVFVLGDTVDKIAWHKAGIMKTGSPAFTIEQVPSATQVLKDR
FOLC_HAEIN      LEVGLGGRLDATNIVDSHLAVITSIDIDHTDFLGDTREAIAFEKAGIFRENCPVVIGENVPQ--TMLDQ-
FOLC_DICDI      LEVGIGGRMDSTNVFKPMVTGISALGYDHQNLLGNTLAEIALEKAGIMKVGIPIFTSSQLPEAINVIDHS
FOLC_BUCBP      LEVGLGGRLDATNILSADVSVITNIDIDHSKILGVNRSSISVEKSGIFKNKIAIVADNNFPK---VAQYL
FOLC_BUCAI      LKVGLGGRLDAXXXXXXXXXXXXXXGIDHTSILGRDRISIAREKCGVFRKNKISVIG-------------
FOLC_YEAST      IETGLAGKQDPGSIISRVCCAITNVGISDEAFLCKFLSQITESST---NKAIFLLDGSNDEFVRNTITKR
MURE_THETN      MEVSSHSLLHRVDSCDFDIAVFTNLSQDHLDF-HESMEEYAKTKSKLFKMAKKASVINIDDKYSSMM---
MURE_BACSU      MEVSSHALLGRVHGCDYDIAVFTNLTQDHLD-YHKTMDEYRHAKSLLFSQGGAFNHEHPKRAVLNADDEA
MURE_CHLTR      MEVGMAGRVRETEFLAGVLTNITS---DHLDFHGSLEEYIAAKKASLPEKGIAVVNCEYAPQARAVSYAI
MURE_CHLTA      MEVGMAGRVRETEFLAGVLTNITS---DHLDFHGSLEEYIAAKKASLPEKGIAVVNCEYAPQARAVSYAI
MURE_CHLCV      MEVSSVGLLAEVDFDVGVLTNITLDHLDFHGSFEEYINAKLKLFSKLPATGLAVVNGD-----LSYASRF
MURE1_CLOAB     MEVSSHSLLDRVYGIEGIFTNLTQDHLD----FHKTFENYYKAKMILFKNSKRSI--------INIDDKY
MURC_LACSS      ----------------------------------------------------------------------
MURE_CLOTE      MEVSSHSLLDGIEFNEGIFTNLTQDHLD----FHKTFENYYNSKLMLFKXXXXXXXXXXXXYGERILKEI
MURE_BACLD      MEVSSHALMGRVHGCDYDIAAFTNLTQDHLD-YHETMEEYKHAKSLLFSQLGGSFNHETPKWAVLNADYF
MURC_LACBA      ----------------------------------------------------------------------
MURE_LEIXX      --------------------GFTNLSHDHL----DDYTAMPDYFAAKLELFQP----DRARRGVVTVDRL
MURE_BORBU      -------------------VVFTNIGHEHLEFHG-TIQNYLNVKLGLFRS----VSDDAGFGVINLDDLY
MURE_ALKOO      MEVSSHGRVDHTKFTMGIFTNLTPEHLD----FHEDMDHYRNAKKKLFYKNVDDIHGKMIAEEL------
MURC_RUTMC      ---------------QPMLSVITNIDYDHMVTYDNDYQNL---KDAFIKANLPFYGACIMCADDEGVNEI
MURE_COXBU      ----------------------------------------------------------------------
MURE_MYCTU      ----------------------------------------------------------------------
MURE_MYCBO      ----------------------------------------------------------------------
MURE_AQUAE      ----------------------------------------------------------------------
MURC_LYSSC      ----------------------------------------------------------------------
MURC_PSYA2      ----------------PMAAIVTNIDQDHMETYGNSFDKL---KAAYIQQNMPFYGLAVVPELYAMIDDI
MURF_TREPA      FELGMGEMRTLAQILVPHYAIITNVGCAHVGILG-TQQAIAEEKKEIFSQFTEHSVGFVPDDAYRV----
MURC_PEDPA      ----------------------------------------------------------------------
MURC_LACAC      ----------------------------------------------------------------------
MURC_LACGA      ----------------------------------------------------------------------
MURE_TREPA      ----------------------------------------------------------------------
MURE_PROM1      ----------------------------------------------------------------------
MURE_PARD8      ----------------------------------------------------------------------
MURE_MYCLE      ----------------------------------------------------------------------
MURC_LACPL      ----------------------------------------------------------------------
MURC_LACJO      ----------------------------------------------------------------------
MURE_STRTD      FDVGV----------------FLNISPDHIGPIEHTFEDYFYHKRLLLKNSQAVIVN----SGMNHFDFV
MURE_STRT2      FDVGV----------------FLNISPDHIGPIEHTFEDYFYHKRLLLKNSQAVIVN----SGMNHFDFV
MURE_STRT1      FDVGV----------------FLNISPDHIGPIEHTFEDYFYHKRLLLKNSQAVIVN----SGMNHFDFV


                         .         .         .         +         .         .         .:280
query           AEEKDAPRLAYGTDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGRE
FOLC_BACSU      AERHAAPFQSLHDACVIFNEEALPAGEQFSFTEEKCYEDIRTSLIGTHQRQNAALSILAAEWLNKENIAH
FOLC_LACCA      XXTTGSQWLRFDRDFSVPKAKLHGWGQRFTYED--QDGRLEVPLVGDYQQRNMAIAIQTAKVYAKQTEWP
FOLD_YEAST      KERCK----ALGSELSV--TDSQLNGNMIDTNSWGCFDLAKLPLNGEYQIFNLRVAMGMLDYLQMNELID
FOLD_SCHPO      AEETRAHPF-----YLAKGKSGENKNEWIINTPNWGTNTFSTPLKGDYQGQNLACAVTALDILSSSFSIM
FOLC_CAEEL      AISKHVPLF----------QTPPVSAYQFDISPGIR---------GAHQFSNVSMALQLVRAWAEKCGFP
FOLC_MOUSE      RAQQIGCPLYLCPPLEALEEVGL---------------PLSLGLEGAHQRSNAALALQLLERQDHQDIQE
FOLE_SCHPO      AAERN-------TSLKVVIPPAELTPDMI-------------GLSGVHQLGNTSLAVSLVQEFYEKAGRD
FOLC_CRIGR      AQQTSCPL------YLCPPLEA----------XXXXXXXXXXXXXXXHQRSNAALALQLLEQQDHQDIRE
FOLC_BOVIN      AQQISCP-LYLCPPLQ---------------AXXXXXXXXXXXXXXXHQRSNAALALQVARCWLQQKGYQ
FOLC_HUMAN      AQQISCPLYLC----------------PMXXXXXXXXXXXXXXXXXXHQRSNAALALQLAHCWLQRQDRH
FOLC_ECOLI      AQEKGALLQRRGVEWNYS-----VTDHDWAFSDA--HGTLENLPLPLVPQPN----XXXXXXXXXXSGLE
FOLE_CANAL      AKQLGVSSLEFVDTEDLPNVKLGLSGEFQKQNAAIRIANSHLKTIGITQD---------LPEFNNNDGKK
FOLE_YEAST      AEERKTTLTEVPPFKQLENVKLGIAGE--------------------FQKSNASLAVMLASEILHEEKIK
FOLC_BUCAP      AKEKKTILKKIDVDW-------------FWTRTKIDSWNFIHSNIELYRIPLSNTAIALASLF--YSGLE
FOLE_NEUCR      AVEK-------GVDLKILDVDPRLNG-VKIRPDAV----FQKKNXXXXXXXXXXXXXXXDPSF--KPGTD
FOLC_HAEIN      AEKLHCQVARRDVDWLFEQNAE-------NWQWQNKKVRLENLPFCQIPLANAATVLAAVQYLPFD----
FOLC_DICDI      NKVKSPLSIVPSID-----QYTISSXXXXXXXXKIE----SIGLKGTHQLENASLAIAL-----------
FOLC_BUCBP      AKKKKVRLRIVNIDWIYKKIE-------FEWSFC----SSKITWLHLPLPRNVSLSVATALSAVSESGIK
FOLC_BUCAI      --ETDIP----CSMYQIAKEKKTILKKIWSWEKKRNYWNFFHSTIQLYQVPLSSAATALSTLYYXXXXXX
FOLC_YEAST      CHDVGCPLEITDRDYNV-HTDTWGTLEVLPYSEEE------------YQIFNLRVAIAVLD-FLSKEKKV
MURE_THETN      IESSKGKVLTYGIKVMAKEIKNSLSGVKFKVQIQDKKEEISLKIPGLFSVYNALAAITVADFL----GIP
MURE_BACSU      SAYFEKVTAAHISTYGIKNDADVMAGTSFDLVTNKGTKHITMSLVGQFNVYNVLAAVAT----CIAAGIP
MURE_CHLTR      HQEADADRLSSGSSYDIWYQ-----GQVFPC---------ETSLIGEHNVYNVLASLAVVHQFL---GRD
MURE_CHLTA      HQEADADRLSSGSSYDIWYQ-----GQVFPC---------ETSLIGEHNVYNVLASLAVVHQFL---GRD
MURE_CHLCV      LEMTQAQPITYGADYRAMHLRSSPFGTDFDLVYRGESLPCRLPLIGKHNVYNILAAIAVAHQHCNGDLQQ
MURE1_CLOAB     GERKDADKITYGADLKAENLKMTSRGTEFDLCYRGLREHVKINIPGKYNVYNALGSVAA----CLNEGIS
MURC_LACSS      --KSNAPIYYYGTDFQARNIQRTVEGSEFDYYHDENIGHYHVPLYGEHNVLNS-LAVIAVSYLEKIDGRE
MURE_CLOTE      EEKTFTYSIKKYSDLKAESVRLHSRGGEFTVDFKGNKEKINIHIPGEYNVSNAGSILA-----CVNEGIS
MURE_BACLD      AQVTSAHLLTYGADVMAENIKMAPKGTTFDLVTPKGSAQVTIPLVGLFNVYN------------------
MURC_LACBA      ----DVPVYYYGTDFQARNIKRSTTGSTFDYHDDEFLGNFEIHLFGEHNVLNAVIAVAYFEKVNMDEIKE
MURE_LEIXX      VEQSRIPVTTLSSDWRVTVLEETLARTAFALEGP--GGRLETSLLGAYNASNAALAIVML----VESGYD
MURE_BORBU      SSDKNAVKKSFKADFFVSFIDEKTDSTRFEFYHKGVKYLANVSLLGSFNVENVMAALILVSQILNIDIQD
MURE_ALKOO      -KEEQIPLITFGADVYATDLKINLKGVSFQLHMGQDSKEFHVKIPGLFTVYNAMPSILI----CYILGLS
MURC_RUTMC      LNSIHRPLITYGTDIQAVNVKQVGMQMYFDYDKYTKQIPIKLNLIGKHNILNTLAAIGICELNIKTNIIQ
MURE_COXBU      ------------------------------------EGTFTTPLFGRFNISNL---LAVLSVLCL---CE
MURE_MYCTU      -------------------------------------------LPGRYNVANCLVALAILDTVG------
MURE_MYCBO      -------------------------------------------LPGRYNVANCLVALAILDTVG------
MURE_AQUAE      -----------------------------------KEYEFSTNLIGDFQAYNLSAAIA----YALWKGIE
MURC_LYSSC      ------PVVYYGNDFEARNVEKTTEGTKFDVF--VRNEFYSTFFIPLFG-DHAILNTLAVITLCEYEG--
MURC_PSYA2      GR----PVLTFGLENDVQAVDLVTEGTKTHFTVLRRDHRLTLNIPGVHNVYNALAAITMATDEGVDDARA
MURF_TREPA      ----------------------------------------------------------------------
MURC_PEDPA      ------PVYYYGTDFQATNISRTTTGSEFDVIKGEKLGRFTINLFGEHNVLNSLAVIAV--AYFEKVDLD
MURC_LACAC      ----DIPKYTYGDDFQAVDIKKTTTGSSFNVLAHGKDGRFEIHLFGDHSILNATAVIAVAYT-------E
MURC_LACGA      ----DIPKYTYGDDFQAVNIEKTTTGSKFNVLAHGKDGRFEIHLFGDHSILNAVIAVAYTEKVPMEDIKE
MURE_TREPA      ----------------------------------------------------------------------
MURE_PROM1      -------------------------------------GNFISPLIGEFNLMNMLQAIGILVQ------RG
MURE_PARD8      ----------------------------------------------------------------------
MURE_MYCLE      ------------------------------------QHRVGIRLPGRYNVANCLVALAILDVVGVSP--E
MURC_LACPL      ----DTPIYYYGTDFQAVNIKRTTKGSSFEVKYHDESGKFEIPLFGEHNVLNSTAVIAVSKVNLDEIRRE
MURC_LACJO      ----DIPKYTYGDDFQAVNIEKTTTGSKFNVLAHGKDGRFEIHLFGDHSILNTTAVIAVAYT-------E
MURE_STRTD      AEEADKDHDFYGKDSEVKHSSG------FSFKAKGKAGDYDIQLIGDFNQDNA-MAAGLA---CLRLG--
MURE_STRT2      AEEADKDHDFYGKDSEVKHSSG------FSFKAKGKAGDYDIQLIGDFNQDNA-MAAGLA---CLRLG--
MURE_STRT1      AEEADKDHDFYGKDSEVKHSSG------FSFKAKGKAGDYDIQLIGDFNQDNA-MAAGLA---CLRLG--


                         .         *         .         .         .         .         +:350
query           LASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADHHKEILFTCIKTKALED
FOLC_BACSU      I-SDEALRSGLVKAAWPGRLELVQEHPPVYLDGAHNEEGVEKLAETMKQRFANSRISVVFSALKDKPYQN
FOLC_LACCA      LTPQN-IRQGLAASHWPARLEKISDTPLIVIDGAHNPDGINGLITALKQLFS-QPITVIAGILADKDYAA
FOLD_YEAST      ITKNE-VSTRLAKVDWPGRLKVSNRTVPILMDGAHNGSAAVELVKYLRKEYGNQPLTFVMAVTHGKNLEP
FOLD_SCHPO      L---PHVQNGVKNTSWPGRLDIRSVPSLILFDGAHNKEAAIELAKFVNSQRREHNKSVVVAFTNTKDVTG
FOLC_CAEEL      LLSTDTSGDAIESCRWPGRSQIVSRNVTYLLDGAHTPKSMEACSEWAAEEIVNLKKELLFQCTADRCPST
FOLC_MOUSE      LRPTPHMRRGLRDTVWPGRTQILQRGPLWYLDGAHTTSSVQA----------------------------
FOLE_SCHPO      PYQDPAILDGLKYVKWPGRCQIEEINNIWCFDGAHTKESLEA----------------------------
FOLC_CRIGR      LKPTSHMRHGLRDTEWPGRTQVLRRGPLWYLDGAHTTSSVQA----------------------------
FOLC_BOVIN      DAGTPRMQQGLRHTEWPGRTQLLRRGPLWYLDGAHTTSSMQA----------------------------
FOLC_HUMAN      GAGTSHMRLGLRNTEWPGRTQVLRRGPLWYLDGAHTASSAQA----------------------------
FOLC_ECOLI      VSEN-AIRDGIASAILPGRFQIVSESPRVIFDVAHNPHAAEYL---------------------------
FOLE_CANAL      KLSNKFI-KGLENVDWPGRCQIINNNPTGIIDGAHTIESINA----------------------------
FOLE_YEAST      CSSNASIPEGLQNTKWEGRCQVLEKGKVWYIDGAHTKDSMVAASTWFRDRLSKRKKILLF----------
FOLC_BUCAP      VNLKK-LKSSISKVQLSGRFQTVFNSPRIILDVAHNVHAALYLSEKIDEIDTEGQIYAVFGILKDKDVAG
FOLE_NEUCR      SLSPEFV-QGLEQVVWRGRCEVKEEDAVWHLDGAHTVDSLK-----------------------------
FOLC_HAEIN      -ISEQTLRKSLQEVELVGRFQAIKTDPTIIVDVGHNPHAAKYL---------------------------
FOLC_DICDI      ----------------------------------------------------------------------
FOLC_BUCBP      INQKVF-RSCISEITLCGRFETISYNPIIILDVAHNPHSARYLFKKMSSFKKNGNIFAVVGILKEKNIKD
FOLC_BUCAI      XXXXXXXXXNVQ---LPGRFQVISTFPYIIVDVAHNPNA-------------------------------
FOLC_YEAST      CISKDQLSQGLISVDWPRSL--------------------------------------------------
MURE_THETN      LRS---VREALSHVTVKGRFEPVERDFYVFIDYAHTPDGIRNIMEALKE---------------------
MURE_BACSU      F---EIITEAVEELGVRGRFELVNQQQPVIVDYAHTPDSLENVLETCRD---------------------
MURE_CHLTR      FA--DLVRDVRFLSAPKGRLDPILLGPFPVIDYAHTPDALNVCRILLQLLPKDGRLIIVFGC--------
MURE_CHLTA      FA--DLVRDVRFLSAPKGRLDPILLGPFPVIDYAHTPDALNVCRILLQLLPKDGRLIIVFGC--------
MURE_CHLCV      LIS-----LAANVESPRGRLEPVFSGPCPIIDYAHTPDALENVCKTLHALLPEQGKLIVFGC--------
MURE1_CLOAB     IEKKDGLNKL---SSVPGRCEIVTHDFDVVLDYAHTPDGLEKVLKASRE---------------------
MURC_LACSS      VVREDFKGVKRRFT------EKKVADVTIIDDYAHHPSEIKATLDAARQKYPDRQIVAVFTFTRTIALMD
MURE_CLOTE      L---KVIKRGLEKLSGPGRCEIVTMGYNLIVDYAHTPDGLDNVLRTARD-FTKGKLISVYGCDRDRAKRP
MURE_BACLD      ----------------------------------------------------------------------
MURC_LACBA      LA--DFKGVKRRFT------ERKLADMTIIDDYAHHPSEIKATLDAARQKYPD--KEIIHTFSRTIALMD
MURE_LEIXX      L---DAIGAALERDGGPGRAERLSGDPVVFIDYGHTPDAFSSTLAALR----------------------
MURE_BORBU      IVDKLNCIKSLD-----GRMDSINQNFSVIIDYAHTPGAFSKLF-PIFKRFATNRLISVFGSAGERDVEK
MURE_ALKOO      LEEISIALEAMKGV--PGRFEVVEQRNSVIIDYAHTPDALENILISTR-KFAPKRIITVFGC--------
MURC_RUTMC      KALANFSGVA-RRLDHHGKLNINNAQVSLFDDYAHHPKEISAVFESLKNTYQDKRLVVIFDFVYTLSSAD
MURE_COXBU      IPFDKALLELSQLRNVPGRMQVVDRQPQIIVDYAHTPDALEKALTALRE---------------------
MURE_MYCTU      -VSPEQAVPGLREIRVPGRLEQIDRGQLALVDYAHKPEALRSVLTTL-----------------------
MURE_MYCBO      -VSPEQAVPGLREIRVPGRLEQIDRGQLALVDYAHKPEALRSVLTTL-----------------------
MURE_AQUAE      ---PDLIQRALKCVNVPGRFEVVHSDKFVIIDYAHTPDAVENVLRTARK---------------------
MURC_LYSSC      -ISPDIIQDRLHTYKGVKRTETDIGDNVLIDDYAHHPTEIRATIQSARQKFPDRELVAIFTFTRTQALQD
MURC_PSYA2      LQKFEGVGRRFEQHA---SVTIDDGDVLLIDDYGHHPKEVDATIKAARQSFPERRLVMLFQPHRYSRTRD
MURF_TREPA      ----------------------------------------------------------------------
MURC_PEDPA      LVQKELL-------TYQGVKRRFSKDNILIDDYAHHPSEIKATLDAARQEFPDKKIVAVFTYSRTAALMD
MURC_LACAC      KVPMDAIREGL--LTFKGAKRRFSEDIAVIDDYAHHPTEMRATIQAARQKFPDKKLVVVFTFSRTKKYQD
MURC_LACGA      -------GLLTFKGAKRRFAEKDFGDVSVIDDYAHHPTEMRATIQAARQKFPDKELVVVFTFSRTKKYQK
MURE_TREPA      ----------------------------------------------------------------------
MURE_PROM1      LPLNDLLEALNKFPGVPGRMQLINMDPLVIVDYAHTPDGLQNALI-------------------------
MURE_PARD8      ----------------------------------------------------------------------
MURE_MYCLE      QASLGF-----RDIRIPGRLERIGQDFLALVDYAHKPGALHSVLTALLQ--PDHRLAVVF----------
MURC_LACPL      LL--DFSGVKRRFS------EHQVGDMVMIDDYAHHPSEIKATLDAARQKYPD--KEILHTFSRTKALMD
MURC_LACJO      KVPMDDIKEGLLTFKGAKRAEKDFGDVSVIDDYAHHPTEMRATIQAARQKFPDKELVVVFTFSRTKKYQK
MURE_STRTD      -ASLEDIKKGIAQTSVPGRMEILTQGAKVFVDYAHNGDSLDKLLQVV----TDHQK--------------
MURE_STRT2      -ASLEDIKKGIAQTSVPGRMEILTQGAKVFVDYAHNGDSLDKLLQVV----TDHQK--------------
MURE_STRT1      -ASLEDIKKGIAQTSVPGRMEILTQGAKVFVDYAHNGDSLDKLLQVV----TDHQK--------------


                         .         .         .         .         *         .         .:420
query           MLDLLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLEQNLTDKKEEKQTVRIVTGSLYF
FOLC_BACSU      MIKRL----ETIAHAIHFASFDFPRASLAKDLYDASEISNKSWSEDPDDKFIESKKGSNEIVLITGSLYF
FOLC_LACCA      MADRLTAAFSTVYLVPVPGTPRALPEAGYEALHEGR--LKDSWQEALAASLNDVPDQP---IVITGSLYL
FOLD_YEAST      LLQPL-LRPIDQVILTRFNNIHATDPEEIKDFILTQGYTKEDLHQVL-PSLAHVSDEQRRPIVVCGSLYL
FOLD_SCHPO      IMKILLRKGDTVIA-TNFSSVSGMPKSMEPEVIKNSISSESSVECYTADNLTISEKEKNSSVIVCGSLYL
FOLC_CAEEL      LIKYLKPLGISQITQLHSSIDKSADSANLNEQAEKANQCVQAWKESLDQPESVTEDQMKVFDCISSAYKF
FOLC_MOUSE      ----------------------------------------------------------------------
FOLE_SCHPO      ----------------------------------------------------------------------
FOLC_CRIGR      ----------------------------------------------------------------------
FOLC_BOVIN      ----------------------------------------------------------------------
FOLC_HUMAN      ----------------------------------------------------------------------
FOLC_ECOLI      ----------------------------------------------------------------------
FOLE_CANAL      ----------------------------------------------------------------------
FOLE_YEAST      ----------------------------------------------------------------------
FOLC_BUCAP      VVQVL-----------------------------------------------------------------
FOLE_NEUCR      ----------------------------------------------------------------------
FOLC_HAEIN      ----------------------------------------------------------------------
FOLC_DICDI      ----------------------------------------------------------------------
FOLC_BUCBP      IVSPLIPIVDYWYCITLLTHRSATSSEIIK----------------------------------------
FOLC_BUCAI      ----------------------------------------------------------------------
FOLC_YEAST      ----------------------------------------------------------------------
MURE_THETN      ----------------------------------------------------------------------
MURE_BACSU      ----------------------------------------------------------------------
MURE_CHLTR      ----------------------------------------------------------------------
MURE_CHLTA      ----------------------------------------------------------------------
MURE_CHLCV      ----------------------------------------------------------------------
MURE1_CLOAB     ----------------------------------------------------------------------
MURC_LACSS      ----------------------------------------------------------------------
MURE_CLOTE      IMGRIGTELSDLAILT--SDNPRTEEDIVKGVTKDNYIIVQSRREAIKKAMTIAK--KDDVIVVAG----
MURE_BACLD      ----------------------------------------------------------------------
MURC_LACBA      DFAKSLNLADKVFLTNIFSSARETQGAV------------------------------------------
MURE_LEIXX      ----------------------------------------------------------------------
MURE_BORBU      RF-LQGQIADIYSDLIILCDEDPRGENIIKDIAK------------------------------------
MURE_ALKOO      ----------------------------------------------------------------------
MURC_RUTMC      ILILLNIYPAQEKPIAHINSS-------------------------------------------------
MURE_COXBU      ----------------------------------------------------------------------
MURE_MYCTU      ----------------------------------------------------------------------
MURE_MYCBO      ----------------------------------------------------------------------
MURE_AQUAE      ----------------------------------------------------------------------
MURC_LYSSC      FADSL-SLADTAYLCDIFGSARET----------------------------------------------
MURC_PSYA2      CFD-------------------------------------------------------------------
MURF_TREPA      ----------------------------------------------------------------------
MURC_PEDPA      ----------------------------------------------------------------------
MURC_LACAC      FEEILRDVDKAYITPIYASAREANGDITSEDLVK--NIPGSEVIDL--DNIADLTKNKNSVIVFMGA---
MURC_LACGA      DFEEILRDVDKAYVTPIYASAREASGDISSEDLVN-NIPGSEVIDL--DNIADLTKHKNAVVVFMGA---
MURE_TREPA      ----------------------------------------------------------------------
MURE_PROM1      ----------------------------------------------------------------------
MURE_PARD8      ----------------------------------------------------------------------
MURE_MYCLE      ----------------------------------------------------------------------
MURC_LACPL      ----------------------------------------------------------------------
MURC_LACJO      DFEEILRDVDKAYVTPIYASAREASGDISSEDLVN-NIPGSEVIDL--DNIADLTKHKNAVVVFMGA---
MURE_STRTD      ----------------------------------------------------------------------
MURE_STRT2      ----------------------------------------------------------------------
MURE_STRT1      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LSQVRAYLMERKNxxxxxxx
FOLC_BACSU      ISDIRKRL------------
FOLC_LACCA      ASAVRQTLLGGKS-------
FOLD_YEAST      CGEL----------------
FOLD_SCHPO      LGDMYRYL------------
FOLC_CAEEL      IESQAA--------------
FOLC_MOUSE      --------------------
FOLE_SCHPO      --------------------
FOLC_CRIGR      --------------------
FOLC_BOVIN      --------------------
FOLC_HUMAN      --------------------
FOLC_ECOLI      --------------------
FOLE_CANAL      --------------------
FOLE_YEAST      --------------------
FOLC_BUCAP      --------------------
FOLE_NEUCR      --------------------
FOLC_HAEIN      --------------------
FOLC_DICDI      --------------------
FOLC_BUCBP      --------------------
FOLC_BUCAI      --------------------
FOLC_YEAST      --------------------
MURE_THETN      --------------------
MURE_BACSU      --------------------
MURE_CHLTR      --------------------
MURE_CHLTA      --------------------
MURE_CHLCV      --------------------
MURE1_CLOAB     --------------------
MURC_LACSS      --------------------
MURE_CLOTE      --------------------
MURE_BACLD      --------------------
MURC_LACBA      --------------------
MURE_LEIXX      --------------------
MURE_BORBU      --------------------
MURE_ALKOO      --------------------
MURC_RUTMC      --------------------
MURE_COXBU      --------------------
MURE_MYCTU      --------------------
MURE_MYCBO      --------------------
MURE_AQUAE      --------------------
MURC_LYSSC      --------------------
MURC_PSYA2      --------------------
MURF_TREPA      --------------------
MURC_PEDPA      --------------------
MURC_LACAC      --------------------
MURC_LACGA      --------------------
MURE_TREPA      --------------------
MURE_PROM1      --------------------
MURE_PARD8      --------------------
MURE_MYCLE      --------------------
MURC_LACPL      --------------------
MURC_LACJO      --------------------
MURE_STRTD      --------------------
MURE_STRT2      --------------------
MURE_STRT1      --------------------