[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55169.1

[Show Plain Result]


## Summary of Sequence Search
    1::347
  118::412     2e-56  41%  412 aa  ODP2_RICFE RecName: Full=Dihydrolipoyllysine-residue
  118::412     2e-55  41%  412 aa  ODP2_RICCN RecName: Full=Dihydrolipoyllysine-residue
  123::408     6e-54  40%  408 aa  ODP2_RICPR RecName: Full=Dihydrolipoyllysine-residue
  116::404     8e-54  40%  404 aa  ODP2_RICTY RecName: Full=Dihydrolipoyllysine-residue
  116::415     8e-54  40%  418 aa  ODP2_RICBR RecName: Full=Dihydrolipoyllysine-residue
  103::398     1e-53  39%  398 aa  ACOC_BACSU RecName: Full=Dihydrolipoyllysine-residue
  116::407     2e-49  37%  409 aa  ODO2_HAEIN RecName: Full=Dihydrolipoyllysine-residue
  101::409     8e-49  36%  411 aa  ODO2_BARVB RecName: Full=Dihydrolipoyllysine-residue
  116::399     2e-48  38%  401 aa  ODO2_RICPR RecName: Full=Dihydrolipoyllysine-residue
  118::408     4e-48  37%  410 aa  ODO2_BARQU RecName: Full=Dihydrolipoyllysine-residue
  116::399     7e-48  37%  401 aa  ODO2_RICFE RecName: Full=Dihydrolipoyllysine-residue
  112::393     2e-47  37%  395 aa  ODO2_RICCN RecName: Full=Dihydrolipoyllysine-residue
  127::431     3e-46  37%  433 aa  ODP2_STAES RecName: Full=Dihydrolipoyllysine-residue
  127::431     3e-46  37%  433 aa  ODP2_STAEQ RecName: Full=Dihydrolipoyllysine-residue
  350::642     5e-46  37%  642 aa  ODP2_MOUSE RecName: Full=Dihydrolipoyllysine-residue
  113::396     1e-45  36%  398 aa  ODO2_RICTY RecName: Full=Dihydrolipoyllysine-residue
  124::428     2e-45  37%  430 aa  ODP2_STAAU RecName: Full=Dihydrolipoyllysine-residue
  221::451     9e-45  42%  452 aa  ODO2_SCHPO RecName: Full=Probable dihydrolipoyllysine-residue
  107::403     2e-44  33%  405 aa  ODO2_ECOLI RecName: Full=Dihydrolipoyllysine-residue
  107::403     2e-44  33%  405 aa  ODO2_ECO57 RecName: Full=Dihydrolipoyllysine-residue
  133::426     3e-44  33%  428 aa  ODP2_BACST RecName: Full=Dihydrolipoyllysine-residue
  341::632     3e-44  36%  632 aa  ODP2_RAT RecName: Full=Dihydrolipoyllysine-residue
  215::462     1e-43  40%  463 aa  ODO2_YEAST RecName: Full=Dihydrolipoyllysine-residue
  125::438     1e-43  32%  440 aa  ODP2_ZYMMO RecName: Full=Dihydrolipoyllysine-residue
  355::647     1e-43  36%  647 aa  ODP2_HUMAN RecName: Full=Dihydrolipoyllysine-residue
  144::447     6e-43  35%  447 aa  ODP2_RHIME RecName: Full=Dihydrolipoyllysine-residue
  114::398     1e-42  34%  400 aa  ODO2_RICBR RecName: Full=Dihydrolipoyllysine-residue
  116::428     5e-42  34%  430 aa  ODP2_STAAW RecName: Full=Dihydrolipoyllysine-residue
  116::428     5e-42  34%  430 aa  ODP2_STAAS RecName: Full=Dihydrolipoyllysine-residue
  116::428     5e-42  34%  430 aa  ODP2_STAAR RecName: Full=Dihydrolipoyllysine-residue
  116::428     5e-42  34%  430 aa  ODP2_STAAN RecName: Full=Dihydrolipoyllysine-residue
  116::428     5e-42  34%  430 aa  ODP2_STAAM RecName: Full=Dihydrolipoyllysine-residue
  116::428     5e-42  34%  430 aa  ODP2_STAAC RecName: Full=Dihydrolipoyllysine-residue
  122::414     7e-42  35%  416 aa  ODO2_RALEH RecName: Full=Dihydrolipoyllysine-residue
  250::539     3e-41  37%  539 aa  OPD22_ARATH RecName: Full=Dihydrolipoyllysine-residue
  114::401     6e-41  35%  410 aa  ODO2_BUCBP RecName: Full=Dihydrolipoyllysine-residue
  170::397     3e-40  39%  399 aa  ODO2_AZOVI RecName: Full=Dihydrolipoyllysine-residue
  125::440     4e-40  30%  442 aa  ODP2_BACSU RecName: Full=Dihydrolipoyllysine-residue
  113::407     1e-39  33%  409 aa  ODO2_PSEAE RecName: Full=Dihydrolipoyllysine-residue
  247::559     2e-39  32%  567 aa  ODP2_HAEIN RecName: Full=Dihydrolipoyllysine-residue
  139::422     4e-39  33%  423 aa  ODB2_PSEPU RecName: Full=Lipoamide acyltransferase component of
  113::438     6e-39  30%  438 aa  ODP2_MYCCT RecName: Full=Dihydrolipoyllysine-residue
  166::483     1e-38  34%  483 aa  ODP2_SCHPO RecName: Full=Dihydrolipoyllysine-residue
  212::437     1e-38  38%  439 aa  ODO2_DICDI RecName: Full=Dihydrolipoyllysine-residue
  327::615     6e-38  31%  630 aa  ODP2_ECOLI RecName: Full=Dihydrolipoyllysine-residue
  344::635     7e-37  32%  635 aa  ODP2_DICDI RecName: Full=Dihydrolipoyllysine-residue
  114::421     7e-37  31%  423 aa  ODO2_STAHJ RecName: Full=Dihydrolipoyllysine-residue
  250::539     1e-36  35%  539 aa  OPD23_ARATH RecName: Full=Dihydrolipoyllysine-residue
  230::533     1e-36  29%  544 aa  ODP2_ACHLA RecName: Full=Dihydrolipoyllysine-residue
  242::547     2e-36  30%  547 aa  ODP2_PSEAE RecName: Full=Dihydrolipoyllysine-residue
  113::416     3e-36  33%  424 aa  ODB2_BACSU RecName: Full=Lipoamide acyltransferase component of
  319::637     6e-36  34%  637 aa  OPD21_ARATH RecName: Full=Dihydrolipoyllysine-residue
  108::418     6e-36  32%  420 aa  ODO2_STAEQ RecName: Full=Dihydrolipoyllysine-residue
  110::420     7e-36  32%  422 aa  ODO2_STAAW RecName: Full=Dihydrolipoyllysine-residue
  110::420     7e-36  32%  422 aa  ODO2_STAAS RecName: Full=Dihydrolipoyllysine-residue
  110::420     7e-36  32%  422 aa  ODO2_STAAN RecName: Full=Dihydrolipoyllysine-residue
  110::420     7e-36  32%  422 aa  ODO2_STAAM RecName: Full=Dihydrolipoyllysine-residue
  110::420     7e-36  32%  422 aa  ODO2_STAAC RecName: Full=Dihydrolipoyllysine-residue
  110::420     7e-36  32%  422 aa  ODO2_STAA8 RecName: Full=Dihydrolipoyllysine-residue
  110::420     7e-36  32%  422 aa  ODO2_STAA3 RecName: Full=Dihydrolipoyllysine-residue
  220::507     1e-35  33%  507 aa  ODP2_CAEEL RecName: Full=Dihydrolipoyllysine-residue
  103::422     2e-35  29%  424 aa  ODO2_STAS1 RecName: Full=Dihydrolipoyllysine-residue
  113::421     2e-35  31%  423 aa  ODO2_STAAR RecName: Full=Dihydrolipoyllysine-residue
  107::394     3e-35  31%  402 aa  ODP2_BUCAP RecName: Full=Dihydrolipoyllysine-residue
  179::420     3e-35  35%  422 aa  ODO2_STAAB RecName: Full=Dihydrolipoyllysine-residue
  226::453     3e-35  32%  455 aa  ODO2_PIG RecName: Full=Dihydrolipoyllysine-residue
  226::453     4e-35  32%  455 aa  ODO2_BOVIN RecName: Full=Dihydrolipoyllysine-residue
  193::411     5e-35  36%  420 aa  ODO2_BUCAI RecName: Full=Dihydrolipoyllysine-residue
  224::451     1e-34  32%  453 aa  ODO2_HUMAN RecName: Full=Dihydrolipoyllysine-residue
  225::452     1e-34  32%  454 aa  ODO2_MOUSE RecName: Full=Dihydrolipoyllysine-residue
  225::452     2e-34  32%  454 aa  ODO2_RAT RecName: Full=Dihydrolipoyllysine-residue
  171::451     2e-34  35%  452 aa  ODP2_LEIXX RecName: Full=Dihydrolipoyllysine-residue
  108::418     2e-34  33%  420 aa  ODO2_STAES RecName: Full=Dihydrolipoyllysine-residue
  115::402     4e-34  32%  410 aa  ODP2_BUCBP RecName: Full=Dihydrolipoyllysine-residue
  125::415     4e-34  31%  417 aa  ODO2_BACSU RecName: Full=Dihydrolipoyllysine-residue
  167::407     5e-34  33%  409 aa  ODO2_TAKRU RecName: Full=Dihydrolipoyllysine-residue
  252::537     2e-33  31%  553 aa  ODP2_RALEH RecName: Full=Dihydrolipoyllysine-residue
  183::500     2e-32  31%  501 aa  ODPX_HUMAN RecName: Full=Pyruvate dehydrogenase protein X
  337::630     5e-32  30%  638 aa  ODP2_AZOVI RecName: Full=Dihydrolipoyllysine-residue
  142::427     9e-32  30%  428 aa  ODB2_PSEAE RecName: Full=Lipoamide acyltransferase component of
  180::458     2e-31  35%  458 aa  ODP2_NEUCR RecName: Full=Dihydrolipoyllysine-residue
  176::500     6e-31  31%  501 aa  ODPX_MOUSE RecName: Full=Pyruvate dehydrogenase protein X
  183::500     7e-31  33%  501 aa  ODPX_BOVIN RecName: Full=Pyruvate dehydrogenase protein X
  324::543     1e-29  33%  553 aa  ODO2_MYCTU RecName: Full=Dihydrolipoyllysine-residue
  324::543     1e-29  33%  553 aa  ODO2_MYCBO RecName: Full=Dihydrolipoyllysine-residue
  177::482     4e-29  32%  482 aa  ODP2_YEAST RecName: Full=Dihydrolipoyllysine-residue
  174::479     4e-27  31%  482 aa  ODB2_HUMAN RecName: Full=Lipoamide acyltransferase component of
  166::384     5e-27  32%  393 aa  ODO2_BUCAP RecName: Full=Dihydrolipoyllysine-residue
  174::479     5e-27  30%  482 aa  ODB2_BOVIN RecName: Full=Lipoamide acyltransferase component of
  148::383     1e-26  29%  384 aa  ODP2_MYCGE RecName: Full=Dihydrolipoyllysine-residue
  173::399     4e-24  27%  402 aa  ODP2_MYCPN RecName: Full=Dihydrolipoyllysine-residue
  134::371     1e-21  31% 1257 aa  ODO1_CORGL RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   95::388     1e-21  26%  396 aa  ODP2_BUCAI RecName: Full=Dihydrolipoyllysine-residue
  174::479     3e-20  26%  482 aa  ODB2_MOUSE RecName: Full=Lipoamide acyltransferase component of
  138::351     2e-18  30% 1247 aa  KGD_MYCPA RecName: Full=2-oxoglutarate decarboxylase;       
  122::335     2e-18  30% 1231 aa  KGD_MYCTU RecName: Full=2-oxoglutarate decarboxylase;       
  122::335     2e-18  30% 1231 aa  KGD_MYCTA RecName: Full=2-oxoglutarate decarboxylase;       
  122::344     2e-18  30% 1238 aa  KGD_MYCLE RecName: Full=2-oxoglutarate decarboxylase;       
  122::335     2e-18  30% 1231 aa  KGD_MYCBP RecName: Full=2-oxoglutarate decarboxylase;       
  122::335     2e-18  30% 1231 aa  KGD_MYCBO RecName: Full=2-oxoglutarate decarboxylase;       
  138::351     3e-18  28% 1243 aa  KGD_MYCVP RecName: Full=2-oxoglutarate decarboxylase;       
  163::376     6e-17  27% 1269 aa  KGD_MYCSS RecName: Full=2-oxoglutarate decarboxylase;       
  163::376     6e-17  27% 1269 aa  KGD_MYCSK RecName: Full=2-oxoglutarate decarboxylase;       
  158::371     6e-17  27% 1264 aa  KGD_MYCSJ RecName: Full=2-oxoglutarate decarboxylase;       
  128::341     4e-16  28% 1238 aa  KGD_MYCUA RecName: Full=2-oxoglutarate decarboxylase;       
  120::331     2e-13  26% 1227 aa  KGD_MYCS2 RecName: Full=2-oxoglutarate decarboxylase;       
    5::56      4e-10  42%   58 aa  ODO2_PSEPU RecName: Full=Dihydrolipoyllysine-residue
  353::387     2e-04  43%  642 aa  ODP2_MOUSE RecName: Full=Dihydrolipoyllysine-residue(query 9->43)
  131::166     2e-04  44%  428 aa  ODP2_BACST RecName: Full=Dihydrolipoyllysine-residue(query 8->43)
  344::378     2e-04  43%  632 aa  ODP2_RAT RecName: Full=Dihydrolipoyllysine-residue(query 9->43)
  358::392     2e-04  43%  647 aa  ODP2_HUMAN RecName: Full=Dihydrolipoyllysine-residue(query 9->43)
  124::160     1e-04  51%  417 aa  ODO2_BACSU RecName: Full=Dihydrolipoyllysine-residue(query 8->44)
  251::286     9e-05  44%  553 aa  ODP2_RALEH RecName: Full=Dihydrolipoyllysine-residue(query 8->43)
  178::211     1e-04  50%  458 aa  ODP2_NEUCR RecName: Full=Dihydrolipoyllysine-residue(query 8->41)
  173::211     4e-05  44%  482 aa  ODP2_YEAST RecName: Full=Dihydrolipoyllysine-residue(query 5->43)
  170::208     2e-05  51%  482 aa  ODB2_BOVIN RecName: Full=Lipoamide acyltransferase component of(query 5->43)
    1::347

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIALEHNIAWQEIQ
ODP2_RICFE      ------------------------------------EEQVAVIKDASKIFASPLAKRLAKMGNIRLESVK
ODP2_RICCN      ------------------------------------EEQVTVIKDVSRIFASPLAKRLAKMRNIRFESVK
ODP2_RICPR      --------------------------------------------DSNKIFASPLAKRLAKIGDIRLENVQ
ODP2_RICTY      --------------------------------------NVEVVKDLSKIFASPLAKRLAKIRNIRLESVQ
ODP2_RICBR      ----------------------------------VKEENITTASDQNNIKVSPLAKRLAKIQNVRIEEIK
ACOC_BACSU      ----------------------------------VKQENKPAASKKDRMKISPVARKIAEKAGLDLKQLK
ODO2_HAEIN      ---------------------------------------------------SPVIRRLLAEHDLQADQIQ
ODO2_BARVB      ---------------------------------------LEQSSSSNTMPPAPSAAKLMAENNIAKSDIL
ODO2_RICPR      --------------------------------------------------LAPSVQKLVTENKLDPNNIK
ODO2_BARQU      ---------------------------------------------------APSAAKLMAENNIAKSDIS
ODO2_RICFE      --------------------------------------------------LAPSVQKLVTENKLDPNNIK
ODO2_RICCN      --------------------------------------------------LAPSVQKLVTENKLDPNNIK
ODP2_STAES      -----VKAMPSVRKYARENGVNIKAVNGSGKNGRITKEDIDAYLXXXXXXXXXXXXXXXXXXXXXXXNAS
ODP2_STAEQ      -----VKAMPSVRKYARENGVNIKAVNGSGKNGRITKEDIDAY------------LXXXXXXXXXXXXXX
ODP2_MOUSE      ------------------------------------------------VFVSPLAKKLAAEKGIDLTQVK
ODO2_RICTY      --------------------------------------------------LAPSVQKLVTENKLDPNNIK
ODP2_STAAU      -----VKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGG----APTASNESAD---------
ODO2_SCHPO      ----------------------------------------------------------------------
ODO2_ECOLI      -------------------------------------------EEQNNDALSPAIRRLLAEHNLDASAIK
ODO2_ECO57      -------------------------------------------EEQNNDALSPAIRRLLAEHNLDASAIK
ODP2_BACST      ----------------------------------------------------PSVRKYAREKGVDIRLVQ
ODP2_RAT        ------------------------------------------------VFVSPLAKKLAAEKGIDLTQVK
ODO2_YEAST      ----------------------------------------------------------------------
ODP2_ZYMMO      -------------------------ISNAGYGNKTENMTASYQEKAGRIKASPLAKRLAKKNHVDLKQVN
ODP2_HUMAN      ------------------------------------------------VFVSPLAKKLAVEKGIDLTQVK
ODP2_RHIME      ---------------------------------------------------SPLARRLAKEAGIDLSAIA
ODO2_RICBR      --------------------------------------------------LAPSVQKLVTENKLDPNNIK
ODP2_STAAW      ----------------------------------------EEVDENRTVKAMPSVRKYAREKGVNIKAVS
ODP2_STAAS      ----------------------------------------EEVDENRTVKAMPSVRKYAREKGVNIKAVS
ODP2_STAAR      ----------------------------------------EEVDENRTVKAMPSVRKYAREKGVNIKAVS
ODP2_STAAN      ----------------------------------------EEVDENRTVKAMPSVRKYAREKGVNIKAVS
ODP2_STAAM      ----------------------------------------EEVDENRTVKAMPSVRKYAREKGVNIKAVS
ODP2_STAAC      ----------------------------------------EEVDENRTVKAMPSVRKYAREKGVNIKAVS
ODO2_RALEH      --------------------------------------------------------KLMAEAGLSAGQVA
OPD22_ARATH     ---------------------------------------------------SPLARKLAEDNNVPLSSIK
ODO2_BUCBP      ---------------------------------------------------SPTVRRLISMHDLRDVDIQ
ODO2_AZOVI      ----------------------------------------------------------------------
ODP2_BACSU      --------------------------------GAGQQDQAEVDPNKRVIAM-PSVRKYAREKGVDIRKVT
ODO2_PSEAE      --------------------------------------------------LSPAARKLAEEAGIDPNSIA
ODP2_HAEIN      ------------------------------------QEQVEA--STGYAHATPVIRRLAREFGVNLDKVK
ODB2_PSEPU      ---------------------------------------------------SPAVRKRALDAGIELRYVH
ODP2_MYCCT      ------------------------------SNDVIVRKQTTTVNKSSTIKATPLARKVAADLNIDLSLVT
ODP2_SCHPO      ------------------------------------KQSKETSSPSNVVFASPLARKLAEEKDLDLSQIR
ODO2_DICDI      ----------------------------------------------------------------------
ODP2_ECOLI      ------------------------------------------------VHATPLIRRLAREFGVNLAKVK
ODP2_DICDI      ---------------------------------------------------TPAARFEASSKGYDLSAIN
ODO2_STAHJ      -----------------------------------NNEETQSNPNNQRVNATPSARRHARENGVDLSTVS
OPD23_ARATH     ---------------------------------------------------SPLARKLAEDNNVPLSDIE
ODP2_ACHLA      -------------------------------------EEVHVVATTGKVLASPVARKLASDLGVDIATIK
ODP2_PSEAE      -------------------------------------------RDGAKVHAGPAVRMLAREFGVELSEVK
ODB2_BACSU      ----------------------------------------------NKKRYSPAVLRLAGEHGIDLDQVT
OPD21_ARATH     --------------------------------------DKPTERKAGFTKISPAAKLLILEHGLEASSIE
ODO2_STAEQ      -----------------------------------NSSESENTQDNSQQRINPSARRHARKNGVDLSEVS
ODO2_STAAW      ----------------------------------VDKAEVNQANDDNQQRINPSARRYARENGVNLAEVS
ODO2_STAAS      ----------------------------------VDKAEVNQANDDNQQRINPSARRYARENGVNLAEVS
ODO2_STAAN      ----------------------------------VDKAEVNQANDDNQQRINPSARRYARENGVNLAEVS
ODO2_STAAM      ----------------------------------VDKAEVNQANDDNQQRINPSARRYARENGVNLAEVS
ODO2_STAAC      ----------------------------------VDKAEVNQANDDNQQRINPSARRYARENGVNLAEVS
ODO2_STAA8      ----------------------------------VDKAEVNQANDDNQQRINPSARRYARENGVNLAEVS
ODO2_STAA3      ----------------------------------VDKAEVNQANDDNQQRINPSARRYARENGVNLAEVS
ODP2_CAEEL      ------------------------------------------------VSASPFAKKLAAENGLDLSGVS
ODO2_STAS1      ------------------------DKSAQPAEATSNDTDDKSQDNNQRVNATPSARKYAREKGIDLSEIA
ODO2_STAAR      ------------------------------------KAEVNQTNDDNQQRVNPSARRYARENGVNLAEVS
ODP2_BUCAP      -----------------------------------------------LVHATPVVRRLARHLNVDLKNIT
ODO2_STAAB      ----------------------------------------------------------------------
ODO2_PIG        ----------------------------------------------------------------------
ODO2_BOVIN      ----------------------------------------------------------------------
ODO2_BUCAI      ----------------------------------------------------------------------
ODO2_HUMAN      ----------------------------------------------------------------------
ODO2_MOUSE      ----------------------------------------------------------------------
ODO2_RAT        ----------------------------------------------------------------------
ODP2_LEIXX      -------AKPPIRKLAKDLGVDLSTVTATGAIGEVTREDV------------------------------
ODO2_STAES      -----------------------------------NSSESENTQDNSQQRINPSARRHARKNGVDLSEVS
ODP2_BUCBP      ---------------------------------------------------TPTVRRLARKFDIKLENIT
ODO2_BACSU      ---------------------------------------------------SPSARKLAREKGIDLSQVP
ODO2_TAKRU      ----------------------------------------------------------------------
ODP2_RALEH      ---------------------------------------------------SPSVRKFARELGVDVSRVP
ODPX_HUMAN      -------------------------------------------------RLSPAARNILEKHSLDASQGT
ODP2_AZOVI      ------------------------------------------------VHAGPAVRQLAREFGVELAAIN
ODB2_PSEAE      ---------------------------------------------------SPAVRQRARDLGIELQFVQ
ODP2_NEUCR      ----------------------------------------------------PAAKRLAREKGIDLRNVK
ODPX_MOUSE      ------------------------------------------HKGTARFRLSPAARNILEKHSLDASQGT
ODPX_BOVIN      -------------------------------------------------RLSPAARNILEKHALDANQGT
ODO2_MYCTU      ----------------------------------------------------------------------
ODO2_MYCBO      ----------------------------------------------------------------------
ODP2_YEAST      ---------------------------------------------------SPLAKTIALEKGISLKDVH
ODB2_HUMAN      ---------------------------------------------------TPAVRRLAMENNIKLSEVV
ODO2_BUCAP      ----------------------------------------------------------------------
ODB2_BOVIN      ---------------------------------------------------TPAVRRLAMENNIKLSEVI
ODP2_MYCGE      ----------------------------------------------------------------------
ODP2_MYCPN      ----------------------------------------------------------------------
ODO1_CORGL      ----------------------------------------------------------------------
ODP2_BUCAI      ----------------------------------------KNFKKDIFFHATPLIRRLARNLNINLYDVV
ODB2_MOUSE      ---------------------------------------------------TPAVRRLAMENNIKLSEVV
KGD_MYCPA       ----------------------------------------------------------------------
KGD_MYCTU       ----------------------------------------------------------------------
KGD_MYCTA       ----------------------------------------------------------------------
KGD_MYCLE       ----------------------------------------------------------------------
KGD_MYCBP       ----------------------------------------------------------------------
KGD_MYCBO       ----------------------------------------------------------------------
KGD_MYCVP       ----------------------------------------------------------------------
KGD_MYCSS       ----------------------------------------------------------------------
KGD_MYCSK       ----------------------------------------------------------------------
KGD_MYCSJ       ----------------------------------------------------------------------
KGD_MYCUA       ----------------------------------------------------------------------
KGD_MYCS2       ----------------------------------------------------------------------
ODO2_PSEPU      ----------------------------------------------------------------------
ODP2_MOUSE      --------SPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSF---------------------------
ODP2_BACST      -------AMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAF---------------------------
ODP2_RAT        --------SPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSF---------------------------
ODP2_HUMAN      --------SPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSF---------------------------
ODO2_BACSU      -------ASPSARKLAREKGIDLSQVPTGDPLGRVRKQDVEAYE--------------------------
ODP2_RALEH      -------ASPSVRKFARELGVDVSRVPGTGPKGRITQEDVQGY---------------------------
ODP2_NEUCR      -------ALPAAKRLAREKGIDLRNVKGSGPGGKITEEDVK-----------------------------
ODP2_YEAST      ----RIFASPLAKTIALEKGISLKDVHGTGPRGRITKADIESY---------------------------
ODB2_BOVIN      ----KTLATPAVRRLAMENNIKLSEVIGSGKDGRILKEDILNY---------------------------


                         .         .         *         .         .         .         .:140
query           GTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPDNVTPYGKIERIPMTPMRKVIAQRMVESYLT
ODP2_RICFE      GSGPHGRIVKQDILSYTPSTVHNKIVRNP---EEYRLVPNN-------------NIRKIIAKRLLESKQT
ODP2_RICCN      GSGPHGRIVKQDILSYTPSTAHNKIVRNP---EEYRLVPNN-------------NIRKIIAKRLLESKQT
ODP2_RICPR      GSGPHGRIVKQDILSYDSSTSSNKIVYRDT--EEYRSVPNN-------------NIRKIIAKRLLESKQT
ODP2_RICTY      GSGPHGRIVKQDILSYSPSTAYN------RDTEEYRSVPNN-------------NIRQIIAKRLLESKQT
ODP2_RICBR      GSGPHGRIIKQDVL----------SHKGGSKALSNKIVSRNPEEY---RLAPNNNIRKIIAKRLLESKQT
ACOC_BACSU      GTGPGGRIVKDDVTKALAEQKKDQA--KPVSEQKAQE-------------IPVTGMRKVIAARMQESLAN
ODO2_HAEIN      GSGVGGRLTRED--------IEREIAKRQAQQVKQEAATEQNTSARSEKRVPMTRLRKRIAERLLEAKNS
ODO2_BARVB      GSGKRGQILKEDVLNVLAQGVKXXXXXXXXXXXXXXXXXXXXXXXXREERVRMTKLRQTIARRLKDAQNT
ODO2_RICPR      GTGRGGRITKCDVLETI--NTTPVTIETPALNKTNEE---------RTQRVRMSRLRKTIAQRLKDSQNT
ODO2_BARQU      GSGKRGQILKEDVLGALAQGXXXXXXXXXXXXXXXXXXPIQEM---REERVRMTKLRQTIARRLKDAQNT
ODO2_RICFE      GTGRDGRITKGDVL---------ETINTPSAATSTPTV--NKTNEERVQRVRMSRLRKTIAQRLKDSQNT
ODO2_RICCN      GTGRDGRITKGDVLA----TINTTTTSAPAISKSNEE---------RVQRVRMSRLRKTIAQRLKDSQNT
ODP2_STAES      AT------------QALPEG----------------DFPETT------EKIP--AMRKAIAKAMVNSKHT
ODP2_STAEQ      XXXXXXDVVNASATQALPEG----------------DFPETT------EKIP--AMRKAIAKAMVNSKHT
ODP2_MOUSE      GTGPEGRIIKKDIDSFVPSKXXXXXXXXXXXXXXXXXXXXX----GVFTDIPISNIRRVIAQRLMQSKQT
ODO2_RICTY      GTGRGGRITKYDVLXXXXXXXXXXXXHA---INKTNEE--------RTQRVRMSRLRKTIAQRLKDSQNT
ODP2_STAAU      --SXXXXXXXXXXXXXXXXSLEGDF------PETTEKIP---------------AMRRAIAKAMVNSKHT
ODO2_SCHPO      ------------------------------------------------DRVKMNRMRLRIAERLKESQNR
ODO2_ECOLI      GTGVGGRLTREDVEKHLXXXXXXXXXXXXXXXXXXXXXXXRSE-----KRVPMTRLRKRVAERLLEAKNS
ODO2_ECO57      GTGVGGRLTREDVEKHLXXXXXXXXXXXXXXXXXXXXXXXRSE-----KRVPMTRLRKRVAERLLEAKNS
ODP2_BACST      GTGKNGRVLKEDIDAFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPETREKMSGIRRAIAKAMVHSKHT
ODP2_RAT        GTGPEGRIIKKDIDSFXXXXXXXXXXXXXXXXXXXXXXXXXV-----FIDIPISNIRRVIAQRLMQSKQT
ODO2_YEAST      -------------------------------VSKAQEPPNSFTPFPRTERVKMNRMRLRIAERLKESQNT
ODP2_ZYMMO      GSGPHGRIIKADIEAFIAEANQNPSVSTPEASGKIT----HDTPHNSIK---LSNMRRVIARRLTESKQN
ODP2_HUMAN      GTGPDGRITKKDIDSFVPSKXXXXXXXXXXXXXXXXXXXXXXX----FTDIPISNIRRVIAQRLMQSKQT
ODP2_RHIME      GSGPHGRVVKKDVETAVSXXXXXXXXXXXXXXXXXEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQT
ODO2_RICBR      GTGKDGRITKGDVLETM----------NXXXXXXXXXXXXXXXXXXXXXXXXMSRLRKTIAQRLKDSQNT
ODP2_STAAW      GSGKNGRITKEDVDAYLNGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKIPA--MRRAIAKAMVNSKHT
ODP2_STAAS      GSGKNGRITKEDVDAYLNGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKIPA--MRRAIAKAMVNSKHT
ODP2_STAAR      GSGKNGRITKEDVDAYLNGGAPXXXXXXXXXXXXXXXXXXXXXXXXXTEKIPA--MRRAIAKAMVNSKHT
ODP2_STAAN      GSGKNGRITKEDVDAYLNGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKIPA--MRRAIAKAMVNSKHT
ODP2_STAAM      GSGKNGRITKEDVDAYLNGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKIPA--MRRAIAKAMVNSKHT
ODP2_STAAC      GSGKNGRITKEDVDAYLNGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKIPA--MRRAIAKAMVNSKHT
ODO2_RALEH      GTGKDGRITKGDXXXXXXXXXXXXXXXXXXXXXXXQQVPVDFAALGDRERVPMSRLRARIAERLLQSQST
OPD22_ARATH     GTGPEGRIVKADVEDFLASGSKETTAKPSKQVDSKVPALDYVD-------IPHTQIRKVTASRLAFSKQT
ODO2_BUCBP      GTGTKNRLTRKDILNYL-KNIRSNTNKKINNYD-LNAYNFNTTHHRSIKRVKMTRLRKKISERLLSTKNN
ODO2_AZOVI      ------------------------------------------------KRVPMTRLRAKVAERLVEAQSS
ODP2_BACSU      GSGNNGRVVKEDIDSFVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREKMSGIRKAIAKAMVNSKHT
ODO2_PSEAE      GTGKGGRVTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDRVE-KRVPMTRLRAKVAERLVEAQSA
ODP2_HAEIN      GTGRKGRIVKEDIEAYVKTAVESXXXXXXXXXXXXXXXXXXXXPFGEIEEVELSRINKISGANLHRNWVI
ODB2_PSEPU      GSGPAGRILHEDL----------DAFMSKPQ-SAAGQTPNGYARRTDSEQVPVIGLRRKIAQRMQDAKRR
ODP2_MYCCT      PTGPNQRILVADILASQPIS-QPAPTPSPSAHQTIAPTIKVVEPSAPLDEVPMNGVRKATVKAMTKSHTE
ODP2_SCHPO      GSGPNGRIIKVDIENFKPVVAPKPSNEXXXXXXXXXXXXXXXXXXGDYEDLPLSNMRKIIASRLAESKNM
ODO2_DICDI      -------------------------------------------------RVKMTRIRQRTAQRLKDSQNT
ODP2_ECOLI      GTGRKGRILREDVQAYVXXXXXXXXXXXXXXXXXXXXMLPDFSKFGEIEEVELGRIQKISGANLSRNWVM
ODP2_DICDI      GTGPNNRILKADVLEFVPQKQEVAXXXXXXXXXXXXXXXXXXSS-GEFTDIPHSNIRKVTAARLTESKQT
ODO2_STAHJ      GKGN--DVVRKDDVXXXXXXXXXXXXXXXXXXXXXXXXXG--APNKPVIREKMSRRKKTAAKKLLEVSNN
OPD23_ARATH     GTGPEGRIVKADIDEYLASSGKGATAKPSKSTDSKAPALDYVD-------IPHSQIRKVTASRLAFSKQT
ODP2_ACHLA      GSGEQGRVMKDDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKPQGDVEVVKITRLRKAVSNAMTRSKSI
ODP2_PSEAE      ASGPKGRILKEDVQVFVKEQLQRSXXXXXXXXXXIPPIPEDFSKFGEVEEVAMTRLMQVGAANLHRSWLN
ODB2_BACSU      GTGAGGRITRKDIQRLIEQNPEELXXXXXXXXXXXXXXXXXXXXYPASKEIPVTGVRKAIASNMKRSKTE
OPD21_ARATH     ASGPYGTLLKSDVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNYEDFPNSQIRKIIAKRLLESKQK
ODO2_STAEQ      GKGN--DVLRKDDVENXXXXXXXXXXXXXXXXNSGSKQTNN-NPSKPVIREKMSRRKKTAAKKLLESNQT
ODO2_STAAW      PKTN-DVVRKEDIDXXXXXXXXXXXXXXXXXXE---EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNN
ODO2_STAAS      PKTN-DVVRKEDIDXXXXXXXXXXXXXXXXXXE---EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNN
ODO2_STAAN      PKTN-DVVRKEDIDXXXXXXXXXXXXXXXXXXE---EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNN
ODO2_STAAM      PKTN-DVVRKEDIDXXXXXXXXXXXXXXXXXXE---EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNN
ODO2_STAAC      PKTN-DVVRKEDIDXXXXXXXXXXXXXXXXXXE---EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNN
ODO2_STAA8      PKTN-DVVRKEDIDXXXXXXXXXXXXXXXXXXE---EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNN
ODO2_STAA3      PKTN-DVVRKEDIDXXXXXXXXXXXXXXXXXXE---EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNN
ODP2_CAEEL      GSGPGGRILASD----LSQAPAKGATSTTTQAVSGQDYTD----------IPLSNMRKTIAKRLTESKST
ODO2_STAS1      AASN--DVVRKEHVDXXXXXXXXXXXXXXXXKEETKKLTQQ-NPSKPVIREKMSRRKKTAAKKLLEVSNN
ODO2_STAAR      PKTN-DVVRKEDIDXXXXXXXXXXXXXXXXXXE---EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNN
ODP2_BUCAP      PSGPKNRILKEDIELYIRNNTSN---KSSFNIEK-----NNTTNFHKFNEIPITNIQQIIGKNLHQNWVN
ODO2_STAAB      -----------------------------------EEKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNN
ODO2_PIG        -------------------------------------------------REKMNRMRQRIAQRLKEAQNT
ODO2_BOVIN      -------------------------------------------------REKMNRMRQRIAQRLKEAQNT
ODO2_BUCAI      -------------------------------------------------RVKMTRLRQRIAERLLDSKNN
ODO2_HUMAN      -------------------------------------------------REKMNRMRQRIAQRLKEAQNT
ODO2_MOUSE      -------------------------------------------------REKMNRMRQRIAQRLKEAQNT
ODO2_RAT        -------------------------------------------------REKMNRMRQRIAQRLKEAQNT
ODP2_LEIXX      --------LREGTQASVFRNIQ------------TPEWPDD-----REERILVKGVRKAIANAMVTSAFS
ODO2_STAES      GKGN--DVLRKD-------DVENXXXXXXXXXXXXXXXXXXXXXXXXVIREKMSRRKKTAAKKLLESNQT
ODP2_BUCBP      GTGRKGRILKEDVISYKNISLFND-IKKSLKKTNVNYYKDNVT-CDDFKSIELTRTQIRSSKNLLKSWLT
ODO2_BACSU      TGDPLGRVRKQDV-----EAYEXXXXXXXXXXXXXXXXXXXXXXFDKVEVQKMSRRRQTIAKRLVEVQQT
ODO2_TAKRU      -------------------------------------LPEPSTLGGRGERVKMSRMRLRIAQRLKEAQNT
ODP2_RALEH      GTGPKGRITQEDVQGYVKGVMSXXXXXXXXXXXXXXXXXEDFTRFGEVESKALSRIKKISGANLHRNWVM
ODPX_HUMAN      ATGPRGIFTKEDALKLVQLKQTGKITESPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKST
ODP2_AZOVI      STGPRGRILKEDVQAMMQKAKEXXXXXXXXXXXXXXXXXVDFAKYGEIEEVPMTRLMQIGATNLHRSWLN
ODB2_PSEAE      GSGPAGRVLHEDLDAYLTQ--DGSVARSGGAAQGYAERHDE-------QAVPVIGLRRKIAQKMQDAKRR
ODP2_NEUCR      GSGPGGKITEEDVK------------------KXXXXXXXXXXXXXXYTDVPISGMRKTIAARLKESVTE
ODPX_MOUSE      ATGPRGIFTKEDALKLVELKQMGKITESPRPMTPPVSIPGQPNAAGTFTEIPASNIRRVIAKRLTESKST
ODPX_BOVIN      ATGPRGIFTKEDALKLVQLK-QTGKITEPRXXXXXXXIPPVSTPEGTFTEIPASNIRRVIAKRLTESKST
ODO2_MYCTU      -------------------------------------------------------IRQITANKTRESLQA
ODO2_MYCBO      -------------------------------------------------------IRQITANKTRESLQA
ODP2_YEAST      GTGPRGRITKADIESYLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDVPISTMRSIIGERLLQS---
ODB2_HUMAN      GSGKDGRILKEDILNYLEKQTXXXDMTVPILVSK----PPVFT--GKDKTEPIKGFQKAMVKTM-SAALK
ODO2_BUCAP      -------------------------------------------------RIKMTRLRQKIAERLLETKNN
ODB2_BOVIN      GSGKDGRILKEDILAILXXXXXXXXXXXXXXXXXXXXXXXXSKPIGKDRTEPVKGFHKAMVKTM-SAALK
ODP2_MYCGE      -------------------------------------------PESKTEQIAISTMRKAIAEAMTKSHAI
ODP2_MYCPN      ------------------------------------------------ETIAITTMRKAIAEAMVKSHEN
ODO1_CORGL      ----------------------------------------------KLPEPGQTPIRKSIAKNMDIS-LE
ODP2_BUCAI      GTGPKNRILKED-LDLYQSNIKENLIEEKNKINFGDXXXXXXXXXXXXD------IQKNIGNNLHRNWMN
ODB2_MOUSE      GSGKDGRILKEDILSFLEKQTXXXXXXXXXXKDRTFPTPIAKPPVGKDRTEPVTGFQKAMVKTM-SAALK
KGD_MYCPA       --------------------------------------------------------------------LE
KGD_MYCTU       --------------------------------------------------------------------LE
KGD_MYCTA       --------------------------------------------------------------------LE
KGD_MYCLE       ----------------------------------------------------------VVVKNMSAS-LD
KGD_MYCBP       --------------------------------------------------------------------LE
KGD_MYCBO       --------------------------------------------------------------------LE
KGD_MYCVP       --------------------------------------------------------------------LD
KGD_MYCSS       --------------------------------------------------------------------LD
KGD_MYCSK       --------------------------------------------------------------------LD
KGD_MYCSJ       --------------------------------------------------------------------LD
KGD_MYCUA       --------------------------------------------------------------------LD
KGD_MYCS2       --------------------------------------------------------------------LE
ODO2_PSEPU      ----------------------------------------------------------------------
ODP2_MOUSE      ----------------------------------------------------------------------
ODP2_BACST      ----------------------------------------------------------------------
ODP2_RAT        ----------------------------------------------------------------------
ODP2_HUMAN      ----------------------------------------------------------------------
ODO2_BACSU      ----------------------------------------------------------------------
ODP2_RALEH      ----------------------------------------------------------------------
ODP2_NEUCR      ----------------------------------------------------------------------
ODP2_YEAST      ----------------------------------------------------------------------
ODB2_BOVIN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           APTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLLSLAVVKTLMKHPYINASLTEDGKTIITHNY
ODP2_RICFE      VPHFYLSIECNVDKLLDIREDINKSFSEDKSTRISVNDFIILAVAKALQELPNANASWGEDA--IRYHNN
ODP2_RICCN      VPHFYLSIECNVDKLLDIREDINKFFSEDKSTRISVNDFIILAVAKALQEVPNANASWGEDA--IRYYNN
ODP2_RICPR      VPHFYLSIECNVDKLLDVREDINKSFSEDKVTKISVNDFIILAVAKALQEVPNANASWSEDA--IRYYNN
ODP2_RICTY      VPHFYLSIECNVDKLLDIREDINKSFSEDKLTKISVNDFIILAVAKALQEVPNANASWAEDA--IRYYNN
ODP2_RICBR      VPHFYLSIECNVDKLLDIREDINKSFGDDKSAKISVNDFIILAVAKALQEVPNANASWGDDA--IRYYNN
ACOC_BACSU      SAQLTITMKADITKLATLQKQLSPTAEERYGTKLTITHFVSRAAVLALQAHPVLNSFYQNE--RIITHPH
ODO2_HAEIN      TAMLTTFNEVDMQPIMTLRKTYGEKFEKQHSVRLGFMSFYIKAVVEALKRYPEVNASI--DGDDVVYHNY
ODO2_BARVB      AAMLTTFNEVDMSAVMGLRKRYKDLFEKKHGVKLGFMGFFTKAVCHALKELPAVNAEI--DGTDIIYKNY
ODO2_RICPR      AAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIEALKLIPSINAEI--DGDDLLYKNY
ODO2_BARQU      AAMLTTFNEVDMSAVMDLRKRYKDLFEKKHGVKLGFMGFFTKAVCHALKEFPTVNAEI--DGTDIVYKNY
ODO2_RICFE      AAILTTFNEIDMSKVIALRNQYKEEFEKKHLVKLGFMSFFVKATIEALKLIPSVNAEI--DGDDLVYKNY
ODO2_RICCN      AAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIEALKLIPSVNAEI--DGDDLVYKNY
ODP2_STAES      APHVTLMDEIDVQELWDHRKKFKE-IAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVHKHY
ODP2_STAEQ      APHVTLMDEIDVQELWDHRKKFKE-IAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVHKHY
ODP2_MOUSE      IPHYYLSVDVNMGEVLLVRKE-LNKMLEGKGK-ISVNDFIIKASALACLKVPEANSSWMD---TVIRQNH
ODO2_RICTY      AAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIEALKLIPSINAEI--DGDDLLYKNY
ODP2_STAAU      APHVTLMDEIDVQALWDHRKKFKE-IAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHY
ODO2_SCHPO      AASLTTFNECDMSAVVALRKKYKDEILKETGVKIGFMSFFSKACTQAMKQIPAINGSIEGEGKTLVYRDF
ODO2_ECOLI      TAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASI--DGDDVVYHNY
ODO2_ECO57      TAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASI--DGDDVVYHNY
ODP2_BACST      APHVTLMDEADVTKLVAHRKK-FKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHY
ODP2_RAT        IPHYYLSVDVNMGEVLLVRKE-LNKMLEGKGK-ISVNDFIIKASALACLKVPEANSSWMD---TVIRQNH
ODO2_YEAST      AASLTTFNEVDMSALMEMRKLYKDEIIKKTGTKFGFMGLFSKACTLAAKDIPAVNGAI--EGDQIVYRDY
ODP2_ZYMMO      IPHIYLTVDVQMDALLKLRSELNESLA-VQNIKISVNDMLIKAQALALKATPNVNVAF--DGDQMLQFSQ
ODP2_HUMAN      IPHYYLSIDVNMGEVLLVRKE-LNKILEGRSK-ISVNDFIIKASALACLKVPEANSSWMD---TVIRQNH
ODP2_RHIME      IPHFYVSVDCELDALMALRAQLNAAAPEKDGKKLSVNDMVIKALALALRDVPDANVSWTD--QNMVKHKH
ODO2_RICBR      AAILTTFNEIDMSKVIALRGKYKDEFEKKHGVKLGFMSFFVRATIEALKLIPSVNAEI--DGDDLVYKNY
ODP2_STAAW      APHVTLMDEIDVQALWDHRKKFKE-IAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHY
ODP2_STAAS      APHVTLMDEIDVQALWDHRKKFKE-IAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHY
ODP2_STAAR      APHVTLMDEIDVQALWDHRKKFKE-IAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHY
ODP2_STAAN      APHVTLMDEIDVQALWDHRKKFKE-IAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHY
ODP2_STAAM      APHVTLMDEIDVQALWDHRKKFKE-IAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHY
ODP2_STAAC      APHVTLMDEIDVQALWDHRKKFKE-IAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHY
ODO2_RALEH      NAILTTFNEVNMKPVMDLRNKYKDRFEKEHGVKLGFMSFFVKAAVHALKKFPLINASI--DGNDIVYHGY
OPD22_ARATH     IPHYYLTVDTCVDKMMGLRSQ-LNSFQEASGKRISVNDLVIKAAALALRKVPQCNSSWTDE--YIRQFKN
ODO2_BUCBP      TASLTTFNEVNMQSILNLRRKYGELFKQKHGIKLGLMSFYVKAVIEALKIFPEINASIDND--EIIYYNY
ODO2_AZOVI      MAMLTTFNEVNMKPVMELRAKYKD-LFEKTGVRLGFMSFFVKAAVEALKRQPGVNASI--DGNDIVYHGY
ODP2_BACSU      APHVTLMDEVDVTNLVAHRKQ-FKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEVIQKHY
ODO2_PSEAE      MAMLTTFNEVNMKPIMDLRSKYKDLFEKKNGVRLGFMSFFVKAATEALKRFPGVNASI--DGNDIVYHGY
ODP2_HAEIN      IPHVTHFDKADITDLEAFRKEALRE-KQKLGVKITPVVFIMKAVAKALEAYPRFNSSITEDAQRLILKKY
ODB2_PSEPU      VAHFSYVEEIDVTALEALRQQLNSKHGDSRGKLTLLPFLVR-ALVVALRDFPQINATYDDEAQIITRHGA
ODP2_MYCCT      IAAFTGMKNTDITETHKMRTE-LKDHAAASGIKLTYLAFIIKAVAKSLRDMPNINVRGDFANNKIQFMHN
ODP2_SCHPO      NPHYYVTVSVNMEKIIRLRAAL--NAMADGRYKLSVNDLVIKATTAALRQVPEVNAAWM--GDFIRQYKN
ODO2_DICDI      AAMLTTFNELDMSALMNMRKTYKDEFEKKHGVKFGFMSAFVKASTIALKEQPIVNASVEEND--IVYHNN
ODP2_ECOLI      IPHVTHFDKTDITELEAFRKQQNEEAAKRKDVKITPVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKY
ODP2_DICDI      IPHYYLTMECRVDKLLKLRSE----LNAMNTVKISVNDFIVKASAAALRDNPVVNSTWTD--QFIRRYHN
ODO2_STAHJ      TAMLTTFNEVDMTNVMELRKRKKEQIKDHDGTKLGFMSFFTKAAVAALKKYPEVNAEI--DGDDMITKQY
OPD23_ARATH     IPHYYLTVDTCVDKLMALRSQ-LNSFKEASGKRISVNDXXXXXXXXXXXXXPQCNSSWTDD--YIRQFKN
ODP2_ACHLA      IPETVLMDEINVDALVNFRNEA-KGLAESKGIKLTYMAFIAKAVLIALKEFPMFNASFNHDTDEVYIKKF
ODP2_PSEAE      VPHVTQFDQSDITDMEAFRV-AQKAAAEKAGVKLTVLPILLKACAHLLKELPDFNSSLAPSGKALIRKKY
ODB2_BACSU      IPHAWTMMEVDVTNMVAYRNSIKDSFKKTEGFNLTXXXXXXXXXXXXLKEFPQMNSMWA--GDKIIQKKD
OPD21_ARATH     IPHLYLQSDVVLDPLLAFRKE----LQENHGVKVSVNDIVIKAVAVALRNVRQANAFWDAEKGDIVMCDS
ODO2_STAEQ      AMLTTFN-EVDMTNVMDLRKRKKEQIKDHDGTKLGFMSFFTKAAVAALKKYPEVNAEI--DGDDMITKQF
ODO2_STAAW      TAMLTTFNEVDMTNVMELRKRKKEQFMDHDGTKLGFMSFFTKASVAALKKYPEVNAEI--DGDDMITKQY
ODO2_STAAS      TAMLTTFNEVDMTNVMELRKRKKEQFMDHDGTKLGFMSFFTKASVAALKKYPEVNAEI--DGDDMITKQY
ODO2_STAAN      TAMLTTFNEVDMTNVMELRKRKKEQFMDHDGTKLGFMSFFTKASVAALKKYPEVNAEI--DGDDMITKQY
ODO2_STAAM      TAMLTTFNEVDMTNVMELRKRKKEQFMDHDGTKLGFMSFFTKASVAALKKYPEVNAEI--DGDDMITKQY
ODO2_STAAC      TAMLTTFNEVDMTNVMELRKRKKEQFMDHDGTKLGFMSFFTKASVAALKKYPEVNAEI--DGDDMITKQY
ODO2_STAA8      TAMLTTFNEVDMTNVMELRKRKKEQFMDHDGTKLGFMSFFTKASVAALKKYPEVNAEI--DGDDMITKQY
ODO2_STAA3      TAMLTTFNEVDMTNVMELRKRKKEQFMDHDGTKLGFMSFFTKASVAALKKYPEVNAEI--DGDDMITKQY
ODP2_CAEEL      IPHYYLTSEIQLDTLLQVREKLNGLLAKGTSGQATINDFIIKASALACQRVPEANSYWMDS--FIRENHH
ODO2_STAS1      TAMLTTFNEIDMTNVMDLRKRKKEQIKDHDGTKLGFMSFFTKAAVAALKKYPEVNAEI--DGDDMITKQY
ODO2_STAAR      TAMLTTFNEVDMTNVMELRKRKKEQFMDHDGTKLGFMSFFTKASVAALKKYPEVNAEI--DGDDMITKQY
ODP2_BUCAP      IPHVTQFDEVNITLLEEFRHKYNTEKKQKNNSKITILPFIIKSVAYGLLEFPIFNSSLSVNKKTIFLKKY
ODO2_STAAB      TAMLTTFNEVDMTNVMELRKRKKEQFMDHDGTKLGFMSFFTKASVAALKKYPEVNAEI--DGDDMITKQY
ODO2_PIG        CAMLTTFNEIDMSNIQDMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDY
ODO2_BOVIN      CAMLTTFNEIDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDY
ODO2_BUCAI      TAMLTTFHEVNMKPIILLRKKYGEDFEKKHNVRIGFMSFFVKAVIQALKNFPEINAYI--DQTDIVFYKN
ODO2_HUMAN      CAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDY
ODO2_MOUSE      CAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDY
ODO2_RAT        CAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDY
ODP2_LEIXX      APHVSVFVDVDATRTMEFVKR-LKSAPDFVGVKVSPLLIMAKAIVWAVRRNPTVNSTWTDE--EIIVRHY
ODO2_STAES      AMLTTFN-EVDMTNVMDLRKRKKEQIKDHDGTKLGFMSFFTKAAVAALKKYPEVNAEI--DGDDMITKQF
ODP2_BUCBP      IPHVTQFDESDITELENFRQKYNSDLKDKS-KKLTILIFVIKAVSKALEMFPKFNGRLNKDNRAIVLNEH
ODO2_BACSU      SAMLTTFNEVDMTAVMNLRKRRKDQFFEQNEVKLGFMSFFTKAVVAALKKYPLLNAEI--QGDELIVKKF
ODO2_TAKRU      CAMLTTFNEVDMSNIQEMRTLHKDAFLKKHSIKLGFMSAFVKAAAHALTDQPAVNAVIDGATNEIVYRDY
ODP2_RALEH      IPHVTNHDEADITELEAFRLQ-LNKENEKSGIKVTMLAFMIKATVAALKKFPNFNASL--DGDNLVLKKY
ODPX_HUMAN      VPHAYATADCDLGAVLKVRQDLVKDDI-----KVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLP--F
ODP2_AZOVI      VPHVTQFESADITELEAFRV-AQKAVAEKAGVKLTVXXXXXXXXXXXXXXXPDFNSSLAPSGQALIRKKY
ODB2_PSEAE      IPHFSYVEEIDVTDLEALRAHLNQKWGGQRGKLTLLPFLVR-AMVVALRDFPQLNARYDDEAEVVTRYGA
ODP2_NEUCR      NPHFFVSTNLSVSKLLKLRQALNS---SADGRKLSVNDFLIKAMGIASKRVPTVNSSW-RDG-VIRQFET
ODPX_MOUSE      VPHAYATADCDLGAVLKVRRDLVKDDI-----KVSVNDFIIRAAAVTLKQMPGVN--VTWDGEGPKQLPS
ODPX_BOVIN      IPHAYATTDCDLGAVLTARQNLVRDDI-----KVSVNDFIIKAAAVTLKQMPNVNASWDGEGAKQLPS--
ODO2_MYCTU      TAQLTQTHEVDMTKIVGLXXXXXXXXXXXXGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDA
ODO2_MYCBO      TAQLTQTHEVDMTKIVGLXXXXXXXXXXXXGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDA
ODP2_YEAST      --TQGXXXXXXXXXXXXXXXXXXXXXXNATANKLSINDLLVKAITVAAKRVPDANAYWLPNENVIRKFKN
ODB2_HUMAN      IPHFGYCDEIDLTELVKLREE-LKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKAS
ODO2_BUCAP      TAMLTTFNEVNMQPIISLRKKYGEFFEKKHGVRIGFMPFFVKAVVESLKKFPEINASI--DKNDIVYYKN
ODB2_BOVIN      IPHFGYCDEVDLTELVKLREE-LKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKAS
ODP2_MYCGE      IPTTVLTFYVNATKLKQYRESVNGYALSKYSMKISYFAFFVKAIVNALKKFPVFNASYDPDQNEIVLNDD
ODP2_MYCPN      IPATILTFYVNATKLKQYRESVNGLALSKYNMKISFFAFFVKAIVNALKKFPVFNGRYDKERNLIVLNKD
ODO1_CORGL      IPTATSVRDMPARLMFENRAMVNDQLKRTRGGKISFTHIIGYAMVKAVMAHPDMNNSYDVDGKTLIVPEH
ODP2_BUCAI      IPHVTQFDEVDITILEKFRQKYNNEKQKKTNENITILVFIIKVVAYALEKFPIFXXXXXXXXXXXXXXXX
ODB2_MOUSE      IPHFGYCDEIDLTQLVKLREE-LKPVALARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKAS
KGD_MYCPA       VPTATSVRAIPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAIKKFPNMNRHYAEDGKTAITPAH
KGD_MYCTU       VPTATSVRAVPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAVKKFPNMNRHYTEDGKTAVTPAH
KGD_MYCTA       VPTATSVRAVPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAVKKFPNMNRHYTEDGKTAVTPAH
KGD_MYCLE       VPTATSVRAVPAKLMIDNRTVINNQLKRNRGGKISFTHLLGYALVQAVKKFPNINRHYAEDGKPIVTPAH
KGD_MYCBP       VPTATSVRAVPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAVKKFPNMNRHYTEDGKTAVTPAH
KGD_MYCBO       VPTATSVRAVPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAVKKFPNMNRHYTEDGKTAVTPAH
KGD_MYCVP       VPTATSVRAIPAKAMIDNRIVINNHLKRTRGGKISFTHLLGYAIVQAVKKFPNMNRHFAEDGKPVVTPAH
KGD_MYCSS       VPTATSVRAIPAKLMIDNRVVINNHLKRTRGGKISFTHLIGYAIVAAVKKFPNMNRHFAEDGKNAVTPAH
KGD_MYCSK       VPTATSVRAIPAKLMIDNRVVINNHLKRTRGGKISFTHLIGYAIVAAVKKFPNMNRHFAEDGKNAVTPAH
KGD_MYCSJ       VPTATSVRAIPAKLMIDNRVVINNHLKRTRGGKISFTHLIGYAIVAAVKKFPNMNRHFAEDGKNAVTPAH
KGD_MYCUA       VPTATSVRAVPAKLLIDNRIVINNQLKRNRGGKISFTHLLGYALVQAVKKFPNMNRHLDVDGKNAVTPAH
KGD_MYCS2       VPTATSVRAIPAKLMIDNRVVINNHLKRTRGGKISFTHLLGYAIVQAVKKFPNMNRHFAVDGKTAITPAH
ODO2_PSEPU      ----------------------------------------------------------------------
ODP2_MOUSE      ----------------------------------------------------------------------
ODP2_BACST      ----------------------------------------------------------------------
ODP2_RAT        ----------------------------------------------------------------------
ODP2_HUMAN      ----------------------------------------------------------------------
ODO2_BACSU      ----------------------------------------------------------------------
ODP2_RALEH      ----------------------------------------------------------------------
ODP2_NEUCR      ----------------------------------------------------------------------
ODP2_YEAST      ----------------------------------------------------------------------
ODB2_BOVIN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VNLAMAVGMDNGLMTPVVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGP
ODP2_RICFE      VDISVAVAIENGLVTPIVKNANQKNIIELSREMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNA
ODP2_RICCN      VDISVAVAIENGLVTPIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNA
ODP2_RICPR      VDISVAVAIENGIVTPIVKDANKKNIIELSREMKTLIKKAKDNKLTPIEFQGGGFTISNLGMYGIKNFNA
ODP2_RICTY      VDISVAVAIENGIVTPIIKDANKKNIIELSHEMKILIKKAKDNKLTPVEFQGGGFTISNLGMYGIKNFNA
ODP2_RICBR      VDISVAVAIENGLVTPIIRNADQKNIVDLSSEMKGLIKKARENKLTPEEFQGGGFTISNLGMYGIKNFNA
ACOC_BACSU      VHLGMAVALENGLVVPVIRHAEKLSLIELAQSISENAKKAREGRAGSEELQGSTFSITNLGAFGVEHFTP
ODO2_HAEIN      FDISIAVSTPRGLVTPVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
ODO2_BARVB      VNAGIAVGTDKGLVVPVVRDADQMSLAEIEKEIGRLGRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTP
ODO2_RICPR      YDIGVAVGTDQGLVVPVVRDADKMGFADVEQAIGDLAKKAREGKLSMSDLSGGTFSISNGGVYGSLLSTP
ODO2_BARQU      VNAGIAVGTDKGLVVPVVRDADQMSLAEIEKEISRLGRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTP
ODO2_RICFE      YDIGVAVGTEQGLVVPVVRDADKMGFAEVEKAIGTLAKKAREGKLSMADLSGGTFSISNGGVYGSLLSTP
ODO2_RICCN      YDIGVAVGTEQGLVVPVVRDADKMGFAEVEKTIGILAKQAREGKLSMADLSGGTFSISNGGVYGSLLSTP
ODP2_STAES      WNIGIAADTDKGLLVPVVKHADRKSIFEISDEINELAVKARDGKLTSEEMKGATCTISNIGSAGGQWFTP
ODP2_STAEQ      WNIGIAADTDKGLLVPVVKHADRKSIFEISDEINELAVKARDGKLTSEEMKGATCTISNIGSAGGQWFTP
ODP2_MOUSE      VDVSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLGMFGIKNFSA
ODO2_RICTY      YDIGVAVGTEQGLVVPVIRDADKMSFADIEQAIGNLAKKAREGKLSISDLSGGTFSISNGGVYGSLLSTP
ODP2_STAAU      WNIGIAADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFTP
ODO2_SCHPO      CDLSIAVATPKGLVTPVIRNAESMSLLEIESAIATLGSKARAGKLAIEDMASGTFTISNGGIFGSLYGTP
ODO2_ECOLI      FDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
ODO2_ECO57      FDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
ODP2_BACST      YNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTP
ODP2_RAT        VDVSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLGMFGIKNFSA
ODO2_YEAST      TDISVAVATPKGLVTPVVRNAESLSVLDIENEIVRLSHKARDGKLTLEDMTGGTFTISNGGVFGSLYGTP
ODP2_ZYMMO      ADISVAVSVEGGLITPILKQADTKSLSALSVEMKELIARAREGRLQPQEYQGGTSSISNMGMFGIKQFNA
ODP2_HUMAN      VDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSA
ODP2_RHIME      ADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEYQGGTTAVSNMGMMGVKDFAA
ODO2_RICBR      YDIGVAVGTEQGLVVPVVRDADKMGFADIEKTIGGLAKKARDGKLSMADLSGGTFSISNGGVYGSLLSTP
ODP2_STAAW      WNIGIAADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFTP
ODP2_STAAS      WNIGIAADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFTP
ODP2_STAAR      WNIGIAADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFTP
ODP2_STAAN      WNIGIAADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFTP
ODP2_STAAM      WNIGIAADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFTP
ODP2_STAAC      WNIGIAADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFTP
ODO2_RALEH      FDIGIAVGSPRGLVVPILRNADQMSLADIEKKIAEFGVKARDGKLSLEELTGGTFSISNGGVFGSMLSTP
OPD22_ARATH     VNINVAVQTENGLYVPVVKDADKKGLSTIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNLGPFGIKQFCA
ODO2_BUCBP      FDISIAISTPRGLVTPVLKNADLMSMAEIEIKIKDFSEKGKNSKLTIDDLIGGNFTITNGGVFGSLFSTP
ODO2_AZOVI      QDIGVAVSSDRGLVVPVLRNAEFMSLAEIEGGINEFGKKAKAGKLTIEEMTGGTFTISNGGVFGSLLSTP
ODP2_BACSU      FNIGIAADTEKGLLVPVVKNADRKSVFEISDEINGLATKAREGKLAPAEMKGASCTITNIGSAGGQWFTP
ODO2_PSEAE      QDIGVAVSSDRGLVVPVLRNAEFMSLAEIEGGIANFGKKAKEGKLTIEDMTGGTFTISNGGVFGSLLSTP
ODP2_HAEIN      INIGVAVDTPNGLVVPVFKNVNKKGIIELSRELMEVSKKAREGKLTASDMQGGCFTISSLGGIGTTHFAP
ODB2_PSEPU      VHVGIATQGDNGLMVPVLRHAEAGSLWANAGEISRLANAARNNKASREELSGSTITLTSLGALGGIVSTP
ODP2_MYCCT      INIGIAVDTPNGLMVPVIKGADHLSVFEIAIKISELANKAKDGKLTRAEMTEATFTVSNFGSVGLDYATP
ODP2_SCHPO      VDISMAVATPSGLITPVIRNTHALGLAEISTLAKDYGQRARNNKLKPEEYQGGTFTISNLGMFPVDQFTA
ODO2_DICDI      VNINVAVSAPRGLVVPVIRNCENLSFADIEKEIGRLSGLARNDALAIEDSIGGTFTISNGGVFGSMFGTP
ODP2_ECOLI      INIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAP
ODP2_DICDI      IDINVAVNTPQGLFTPIVRGVDMKGLNSISTSVKQLAEKAQNGKLHPSEFESGTFTISNLGMLGIKQFAA
ODO2_STAHJ      YDIGVAVSTDDGLLVPFVRDCDKKNFAELERAIADLAVKARDKKLGLDDMVNGSFTITNGGVFGSMMSTP
OPD23_ARATH     VNINVAVQTENGLYVPVVKDADRKGLSTIGEEVRLLAQKAKENSLKPEDYEGGTFTVSNLGPFGIKQFCA
ODP2_ACHLA      INLGMAVDTPDGLIVPNIKNADRLSVFELASQVRSLADDTIARKISMDQQTGGTFTITNFGSAGIAFGTP
ODP2_PSEAE      VHIGFAVDTPDGLLVPVIRDVDRKSXXXXXXXXXXXXXXXRNKKLSADAMQGACFTISSLGHIGGTGFTP
ODB2_BACSU      INISIAVATEDSLFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNTGSFGVQSMG-
OPD21_ARATH     VDISIAVATEKGLMTPIIKNADQKSISAISLEVKELAQKARSGKLAPHEFQGGTFSISNLGMYPVDNFCA
ODO2_STAEQ      YDIGIAVSTDDGLLVPFVRDCDKKNFAEIEQEIANLAVKARDKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODO2_STAAW      YDIGVAVSTDDGLLVPFVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODO2_STAAS      YDIGVAVSTDDGLLVPFVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODO2_STAAN      YDIGVAVSTDDGLLVPFVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODO2_STAAM      YDIGVAVSTDDGLLVPFVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODO2_STAAC      YDIGVAVSTDDGLLVPFVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODO2_STAA8      YDIGVAVSTDDGLLVPFVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODO2_STAA3      YDIGVAVSTDDGLLVPFVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODP2_CAEEL      VDVSVAVSTPAGLITPIIFNAHAKGLATIASEIVELAQRAREGKLQPHEFQGGTFTVSNLGMFGVSDFTA
ODO2_STAS1      YDIGVAVSTEDGLLVPFVRDCDKKNFAEIEDEIGNLAKKARDKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODO2_STAAR      YDIGVAVSTDDGLLVPFVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODP2_BUCAP      VNVGIAVDVQNALFVPVLKNVDKKNIANLSSELIFLSKKAHENKLDASDMKDGCFTISNLGGIGGSWFSP
ODO2_STAAB      YDIGVAVSTDDGLLVPFVRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODO2_PIG        IDISVAVATPRGLVVPVIRNVETMNYADIERTISELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTP
ODO2_BOVIN      IDISVAVATPRGLVVPVIRNVETMNYADIERTISELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTP
ODO2_BUCAI      FDISIAISTPRGLITPVIRNADTMTMAEIEKKIKDFSIKGLQNKINIKELMGGNFTITNGGVFGSLMSTP
ODO2_HUMAN      IDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTP
ODO2_MOUSE      IDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTP
ODO2_RAT        IDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTP
ODP2_LEIXX      VNLGIAAATPRGLIVPNVKEAQGMSXXXXXXXXXXXXXXXREGKTQPADMANGTITITNIGVFGMDTGTP
ODO2_STAES      YDIGIAVSTDDGLLVPFVRDCDKKNFAEIEQEIANLAVKARDKKLGLDDMVNGSFTITNGGIFGSMMSTP
ODP2_BUCBP      INIGIVVDTDDGLLVPVINRVNKKNISSISNDLRIISERARSRKLNFSDIKEGSFTISNLGGIGGTNFTP
ODO2_BACSU      YDIGIAVAADEGLVVPVVRDADRLTFAGIEKEIGELAKKARNNKLTLSELQGGSFTITNGGTFGSLMSTP
ODO2_TAKRU      VDISVAVATPKGLVVPVIRNVETMNFADIERTINALGEKARNNELAVEDMDGGTFTISNGGVFGSLFGTP
ODP2_RALEH      FNIGFAADTPNGLVVPVIKDADKKGVLEISQEMSELAKLARDGKLKPDQMQGGCFSISSLGGLGGTYFTP
ODPX_HUMAN      IDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTA
ODP2_AZOVI      VHIGFAVDTPDGLLVPVIRNVDXXXXXXXXXXXXXXXXXXXXXXXGADAMQGACFTISSLGHIGGTAFTP
ODB2_PSEAE      VHVGIATQSDNGLMVPVLRHAESRDLWGNASEVARLAEAARSGKAQRQEXXXXXXXXXXXXXXXXXXXXP
ODP2_NEUCR      VDVSVAVATPNGLITPIVKGVEGKGLESISAAVKELAKKARDGKLKPEEYQGGSISISNMGMNAVQSFTA
ODPX_MOUSE      VDISVAVATDKGLITPIIKDAAAKGIQEIADSVKVLSKKARDGKLMPEEYQGGSFSISNLGMFGIDEFAA
ODPX_BOVIN      IDISVAVATDRGLITPVIKDAAAKGLQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTA
ODO2_MYCTU      EHLGFAVDTEQGLLSPVIHDAGDLSLAGLXXXXXXXXXXXXSGNLKPDELSGGTFTITNIGSQGALFDTP
ODO2_MYCBO      EHLGFAVDTEQGLLSPVIHDAGDLSLAGLXXXXXXXXXXXXSGNLKPDELSGGTFTITNIGSQGALFDTP
ODP2_YEAST      VDVSVAVATPTGLLTPIVKNCEAKGLSQISNEIKELVKRARINKLAPEEFQGGTICISNMGMNAVNMFTS
ODB2_HUMAN      HNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKP
ODO2_BUCAP      IDVSIAVSTPRGVITPVLRNADNMSMADIEKKIKEFSXXXXXXXXXXXXXXXXXXXXXXXXXXXSLMSTP
ODB2_BOVIN      HNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKP
ODP2_MYCGE      INVGIAVDTEEGLIVPNIKQAQTKSVVEIAQAIVDLANKARTKKIKLTDLNKGTISVTNFGSLGAAVGTP
ODP2_MYCPN      VNVGIAVDTPDGLIVPNIKQAQTKSVVDIAKDIVDLANRARSKQIKLPDLSKGTISVTNFGSLGAAFGTP
ODO1_CORGL      INLGLAIDLSRALVVAAIKETEKMNFSEFLAAYEDIVARSRKGKLTMDDYQGVTVSLTNPGGIGTRHSVP
ODP2_BUCAI      XXXGFAIDVNNDLFVPVLKDVNKKNIKQLSSELILLSEKARTRKLNIEDMTGGCFTISNLGGIGGSWFSP
ODB2_MOUSE      HNIGIAMDTELGLIVPNVKNVQVRSVFGIGMELNRLQKXXXXXXXXXXXXXXXXXXXXNIGSIGGTYAKP
KGD_MYCPA       TNLGLAIDLQGSLVVAGIKNCETMRFAQFVTAYEDIVRRARDGKLTAEDFAGVTISLTNPGTIGTVHSVP
KGD_MYCTU       TNLGLAIDLQGSLVVAGIKRCETMRFAQFVTAYEDIVRRARDGKLTTEDFAGVTISLTNPGTIGTVHSVP
KGD_MYCTA       TNLGLAIDLQGSLVVAGIKRCETMRFAQFVTAYEDIVRRARDGKLTTEDFAGVTISLTNPGTIGTVHSVP
KGD_MYCLE       TNLGLAIDLQGSLVVAGIKRCEELRFAQFVTAYEDIVRRARDGKLTAEDFAGVTISLTNPGTIGTVHSVP
KGD_MYCBP       TNLGLAIDLQGSLVVAGIKRCETMRFAQFVTAYEDIVRRARDGKLTTEDFAGVTISLTNPGTIGTVHSVP
KGD_MYCBO       TNLGLAIDLQGSLVVAGIKRCETMRFAQFVTAYEDIVRRARDGKLTTEDFAGVTISLTNPGTIGTVHSVP
KGD_MYCVP       TNLGLAIDLPGSLVVAAIKNCETMHFGQFIAAYEDIVRRARDGKLTAEDFAGVTISLTNPGTIGTVHSVP
KGD_MYCSS       TNLGLAIDLNRQLVVAAIKKADTMRFGQFIAAYEDIVRRARDGKLTAEDFSGVTISLTNPGTIGTVHSVP
KGD_MYCSK       TNLGLAIDLNRQLVVAAIKKADTMRFGQFIAAYEDIVRRARDGKLTAEDFSGVTISLTNPGTIGTVHSVP
KGD_MYCSJ       TNLGLAIDLNRQLVVAAIKKADTMRFGQFIAAYEDIVRRARDGKLTAEDFSGVTISLTNPGTIGTVHSVP
KGD_MYCUA       TNLGLAIDLQGALVVAGIKRCETMRFAQFVTAYEDIVRRARDGKLTAEDFSGVTISLTNPGTIGTVHSVP
KGD_MYCS2       TNLGLAIDLNRSLVVAAIKRCETMRFGQFIAAYEDIVRRARDGKLTAEDFSGVTISLTNPGTLGTVHSVP
ODO2_PSEPU      ----------------------------------------------------------------------
ODP2_MOUSE      ----------------------------------------------------------------------
ODP2_BACST      ----------------------------------------------------------------------
ODP2_RAT        ----------------------------------------------------------------------
ODP2_HUMAN      ----------------------------------------------------------------------
ODO2_BACSU      ----------------------------------------------------------------------
ODP2_RALEH      ----------------------------------------------------------------------
ODP2_NEUCR      ----------------------------------------------------------------------
ODP2_YEAST      ----------------------------------------------------------------------
ODB2_BOVIN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IINQPNSAILGVSSTIEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI
ODP2_RICFE      IINPPQSCIMGVGASAKRAIVKNDQVTIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPALMLI
ODP2_RICCN      IINPPQSCIMGVGASAKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLVAFKKFIESPVLMLI
ODP2_RICPR      IINTPQSCIMGVGASTKRAIVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIENPVLMLI
ODP2_RICTY      IINTPQSCIMGVGASTKRAIVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIEHPVLMLI
ODP2_RICBR      IINPPQSCIMGVGSSSKRAIVKNDQISIATIMDVTLSADHRVVDGAVGAEFLAAFKRFIESPALMLL
ACOC_BACSU      ILNPPETGILGIGASYDTPVYQGEEIVRSTILPLSLTFDHRACDGAPAAAFLKAMKTYLEEPAALIL
ODO2_HAEIN      IINPPQSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL
ODO2_BARVB      ILNAPQSGILGMHAIKERAMVVDGQIAIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERLVL
ODO2_RICPR      IINPPQSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLL
ODO2_BARQU      ILNAPQSGILGMHAIKERAMVVGGQIIICPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERLVL
ODO2_RICFE      IINPPQSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKELIENPEKLLL
ODO2_RICCN      IINPPQSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLL
ODP2_STAES      VINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLM
ODP2_STAEQ      VINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLM
ODP2_MOUSE      IINPPQACILAIGASEDKLIPADNEFDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMLL
ODO2_RICTY      IINPPQSGILGLHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLL
ODP2_STAAU      VINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLM
ODO2_SCHPO      IINLPQTAVLGLHAIKERPVVINGQVVPRPMMYLALTYDHRMVDGREAVTFLRLVKEYIEDPAKMLL
ODO2_ECOLI      IINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL
ODO2_ECO57      IINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL
ODP2_BACST      VINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIKRLLSDPELLLM
ODP2_RAT        IINPPQACILAIGASEDKLIPADNEFDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPVTMLL
ODO2_YEAST      IINSPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRLLDGREAVTFLKTVKELIEDPRKMLL
ODP2_ZYMMO      VINPPQASILAIGSGERRPWXXXXXXXXXXXXXXXGSFDHRVIDGADAAAFMSAFKHLVEKPLGIL-
ODP2_HUMAN      IINPPQACILAIGASEDKLVPADNEFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL
ODP2_RHIME      VVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDHRCVDGALGAELLAAFKRYIENPMGMLV
ODO2_RICBR      IINPPQSGILGLHKTEERVVAIDGKIEIRPMMYIALSYDHRIIDGKEAVSFLVKIKELIESPEKLLL
ODP2_STAAW      VINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLM
ODP2_STAAS      VINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLM
ODP2_STAAR      VINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLM
ODP2_STAAN      VINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLM
ODP2_STAAM      VINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLM
ODP2_STAAC      VINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLM
ODO2_RALEH      IINPPQSAILGVHATKDRPVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPARLLL
OPD22_ARATH     VINPPQAAILAIGSAEKRVVPGTGQYNVASYMSVTLSCDHRVIDGAIGAEWLKAFKGYIETPESMLL
ODO2_BUCBP      LINPPQSAILGMHAIHKRPVIVDENIEVHPMMYLALSYDHRLIDGKESVGFLLKIKEFLE-------
ODO2_AZOVI      IVNPPQTAILGMHKIQERPMAVNGQVVILPMMYLALSYDHRLIDGKEAVTFLVTMKDLLEDPARLLL
ODP2_BACSU      VINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGATAQNALNHIKRLLNDPQLILM
ODO2_PSEAE      IVNPPQTAILGMHKIQERPMAVNGQVVILPMMYLALSYDHRLIDGKEAVSFLVAIKDLLEDPARLLL
ODP2_HAEIN      IVNAPEVAILGVSKSSMEPVWNGKEFAPRLILPMSLSFDHRVIDGADGARFISYLGSVL--------
ODB2_PSEPU      VVNTPEVAIVGVNRMVERPVVIDGQIVVRKMMNLSSSFDHRVVDGMDAALFIQAVRGLLEQPACLFV
ODP2_MYCCT      IINSPESAILGVGTMSQTPLYINGELQKRFIMPLSMTCDHRIIDGADAGRFLIKVQDYLSKPVLLFM
ODP2_SCHPO      IINPPQACILAXXXXXXXXXXXXXXFKVAPIMKCTLSSDHRVVDGAMAARFTTALKKILENPLEIML
ODO2_DICDI      IINPPQSAILGMHAIKDRPYVVNGQVVVRPIMYLALTYDHRIIDGREAVTFLKKIKDVLENPERILL
ODP2_ECOLI      IVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFI---------------
ODP2_DICDI      VINPPQAAILAVGTTETRVVLSNSPYETATILSVTLSCDHRVIDGAVGAEWLKSFKDYVENPIKLIL
ODO2_STAHJ      IINGNQAAILGMHSIITRPIAIDKDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIESPEDLLL
OPD23_ARATH     VVNPPQAAILAVGSAEKRVVPGNGQFNFASYMPVTLSCDHRVVDGAIGAEWLKAFKGYIENPKSMLL
ODP2_ACHLA      VINYPELAILGIGKIDRKPWVVGNEIKIAHTLPLSLAVDHRIIDGADGGRFLMRVKE----------
ODP2_PSEAE      IVNAPEVAILGVSKATMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGELLADIRTLLL
ODB2_BACSU      IINYPQAAILQVESIVKRPVVMNGMIAVRDMVNLCLSLDHRVLDGLVCGRFLGRVKQILES------
OPD21_ARATH     IINPPQAGILAVGDGIEKPSVVTK-------MNVTLSADHRIFDGQVGASFMSELRSNFEDVRRLLL
ODO2_STAEQ      IINGNQAAILGMHSIITRPIAVDKDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODO2_STAAW      IINGNQAAILGMHSIITRPIAIDQDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODO2_STAAS      IINGNQAAILGMHSIITRPIAIDQDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODO2_STAAN      IINGNQAAILGMHSIITRPIAIDQDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODO2_STAAM      IINGNQAAILGMHSIITRPIAIDQDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODO2_STAAC      IINGNQAAILGMHSIITRPIAIDQDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODO2_STAA8      IINGNQAAILGMHSIITRPIAIDQDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODO2_STAA3      IINGNQAAILGMHSIITRPIAIDQDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODP2_CAEEL      IINPPQSCILAIGGASDKLVPDEAEGYKKKTMKVTLSCDHRTVDGAVGAVWLRHFKEFLEKPHTMLL
ODO2_STAS1      IINGSQAAILGMHSIITRPIAIDADIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODO2_STAAR      IINGNQAAILGMHSIITRPIAIDQDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODP2_BUCAP      IINSPEVAILGVSKALIKPLWNGKEFIPSLMLPLSLSYDHRVINGADAARFLTFIGKML--------
ODO2_STAAB      IINGNQAAILGMHSIITRPIAIDQDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODO2_PIG        IINPPQSAILGMHAIVDRPVAVGGKVEIRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLL
ODO2_BOVIN      IINPPQSAILGMHAIVDRPVVIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLL
ODO2_BUCAI      IINPPQTAILGMHVIQERPVVVNGQIKILPMMYLALSYDHRLIDGKESVGFLINIKNILE-------
ODO2_HUMAN      IINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLL
ODO2_MOUSE      IINPPQSAILGMHAIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLL
ODO2_RAT        IINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLL
ODP2_LEIXX      ILNPGEVGIVALGTIKQKPWVVDGEVRPRFVTTLGGSFDHRVVDGDVASRFLADVASIIEEPALLL-
ODO2_STAES      IINGNQAAILGMHSIITRPIAVDKDIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ODP2_BUCBP      IIKYPELAILGISRALIKPYWNSHAFIPKLMLPLSLSYDHRAIDGVAAVRFITFVKKML--------
ODO2_BACSU      ILNSPQVGILGMHKIQLRPVAIDEEFENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLL
ODO2_TAKRU      IINPPQSAILGMHGIFQRPVAVDGKAEIRPMMYVALTYDHRLVDGREAVTFLRKIKAAVEDPRALLL
ODP2_RALEH      IINAPEVAIMGVCKSYQKPVWDGKQFAPRLTLPLSLSWDHRVIDGAEAARF----------------
ODPX_HUMAN      VINPPQACILAVGRF--RPVLKNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRL--
ODP2_AZOVI      IVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLL--------
ODB2_PSEAE      VINHPEVAIVGVNRIVERPMVVGGNIVVRKMMNLSSSFDHRVVDGMDAAAFIQAVRGLLEHPATLFL
ODP2_NEUCR      IINPPQAAILAVGAPQKVAVPVENEDGTTGVIIVTASFDHKVVDGAVGAEWIRELKKVIENPLELLL
ODPX_MOUSE      VINPPQACILAVGRF--RPVLKNPQLQQHQLITVTMSSDSRVVDDELATRFLETFKANLENPMRL--
ODPX_BOVIN      VINPPQACILAVGRF--RPVLKNAQLQQRQLITVTMSSDSRVVDDELATRFLESFKANLENPLRL--
ODO2_MYCTU      ILVPPQAAMLGTGAIVKRPRVVNESIGVRSVCYLPLTYDHRLIDGADAGRFLTTIKHRLE-------
ODO2_MYCBO      ILVPPQAAMLGTGAIVKRPRVVNESIGVRSVCYLPLTYDHRLIDGADAGRFLTTIKHRLE-------
ODP2_YEAST      IINPPQSTILAIXXXXXXXXXXNGFSFDNQVTITG-TFDHRTIDGAKGAEFMKELKTVIENPLEMLL
ODB2_HUMAN      VIMPPEVAIGALGSIKAIPFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLL
ODO2_BUCAP      IINPPQSAILGMHLIKERPMAINGKVKILPMMYLALSYDHRLIDGKESVSFLVTIKNILE-------
ODB2_BOVIN      VILPPEVAI-GALGTIKALPRFNGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLL
ODP2_MYCGE      IIKYPEMCIVATGNLEERIVKVENGIAVHTILPLTIAADHRWVDGADVGRFGKEIAKQIEELIDLTV
ODP2_MYCPN      IIKHPEMCIVATGNMEERVVRAEGGVAVHTILPLTIAADHRWVDGADVGRFGKEIAKQIEELIDL--
ODO1_CORGL      RLTKGQGTIIGVGS-MDYPAEFQGELGVGKLVTITSTYDHRVIQGAVSGEFLRTMSRLL--------
ODP2_BUCAI      IINSPEVAILGISKSQIKPSWNGKEFIPSLMLPLSLSYDHRVINGAYAARFITFISRVL--------
ODB2_MOUSE      VILPPEVAILGAIKALPR-FDQKGDVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLL
KGD_MYCPA       RLMNGQGAIIGVGA-MEYPAEFQGELGIGKLITLTSTYDHRIIQGAESGDFLRTIHEML--------
KGD_MYCTU       RLMPGQGAIIGVGA-MEYPAEFQGELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELL--------
KGD_MYCTA       RLMPGQGAIIGVGA-MEYPAEFQGELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELL--------
KGD_MYCLE       RLMTGQGAIIGVGA-MEYPAEFQGELGIGKLITLTSTYDHRIIQGAESGDFLRTIHEMV--------
KGD_MYCBP       RLMPGQGAIIGVGA-MEYPAEFQGELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELL--------
KGD_MYCBO       RLMPGQGAIIGVGA-MEYPAEFQGELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELL--------
KGD_MYCVP       RLMKGQGAIVG-AGAMEYPAEFQGELGVGKLMTLTSTYDHRIIQGAESGDFLRTIHTLL--------
KGD_MYCSS       RLMRGQGAIIGVGA-MEYPAEFQGDLGIGKLITLTSTYDHRIIQGAESGDFLRTVHQLL--------
KGD_MYCSK       RLMRGQGAIIGVGA-MEYPAEFQGDLGIGKLITLTSTYDHRIIQGAESGDFLRTVHQLL--------
KGD_MYCSJ       RLMRGQGAIIGVGA-MEYPAEFQGDLGIGKLITLTSTYDHRIIQGAESGDFLRTVHQLL--------
KGD_MYCUA       RLMAGQGAIIGVGA-MEYPAEFQGELGIGKLITLTSTYDHRIIQGAESGDFLRTIHQML--------
KGD_MYCS2       RL-MXXXXXXXXXXXMEYPAEFQGDLGIGKLITLTSTYDHRIIQGAESGDFLRTIHQ----------
ODO2_PSEPU      ---------------IQRPMAINGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLL
ODP2_MOUSE      -------------------------------------------------------------------
ODP2_BACST      -------------------------------------------------------------------
ODP2_RAT        -------------------------------------------------------------------
ODP2_HUMAN      -------------------------------------------------------------------
ODO2_BACSU      -------------------------------------------------------------------
ODP2_RALEH      -------------------------------------------------------------------
ODP2_NEUCR      -------------------------------------------------------------------
ODP2_YEAST      -------------------------------------------------------------------
ODB2_BOVIN      -------------------------------------------------------------------